KEGG   Prochlorococcus marinus MIT 9215: P9215_03121Help
Entry
P9215_03121       CDS       T00598                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(283484..284050)
Genome map
AA seq 188 aa AA seqDB search
MELSNLNIKNGLCISLGANIDSKFGSPFESLLICKPKIEEIINEWGHLSNKKKEEKRNFH
ANFLWSSIYETLPHGVENEQPNYFNTLLLIQSNSFPKPSNKNAKLLLKELKKLEGFFGRE
KTPKGKKWLSRCLDLDILWWEDFHTFDEELTLPHPRFMNRNFVITPLSEILSRSQKIKKF
DDPKWSIK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggaattatcaaatcttaatatcaaaaatggactatgtatatcccttggagcaaatatt
gatagtaaattcggaagcccttttgagtcactattaatttgtaaaccaaaaatagaagaa
ataatcaatgaatggggacatctttccaacaaaaaaaaagaagagaaaagaaattttcat
gcaaactttttatggtcatcaatttatgagacattacctcatggagttgaaaatgagcag
ccaaattactttaatactctattacttattcaaagtaattcttttccaaaaccatcaaat
aaaaatgcgaaattacttttaaaagagcttaaaaagttagagggatttttcggacgagaa
aagacgccaaagggtaagaaatggctatcaagatgtctagatttagatattctttggtgg
gaagattttcatacgtttgatgaggaattaacattacctcaccctagattcatgaatcgg
aatttcgttattacgccattatctgagatcttaagtagaagccaaaaaatcaagaagttt
gatgatccaaaatggtctattaaatga

DBGET integrated database retrieval system