KEGG   Prochlorococcus marinus MIT 9215: P9215_06171Help
Entry
P9215_06171       CDS       T00598                                 

Gene name
folE
Definition
(GenBank) putative GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00790  Folate biosynthesis
pmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    P9215_06171 (folE)
Enzymes [BR:pmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     P9215_06171 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Toprim_2 DUF5499 TEX33
Motif
Other DBs
NCBI-ProteinID: ABV50232
CyanoBase: P9215_06171
UniProt: A8G3Q1
Position
543323..544069
Genome map
AA seq 248 aa AA seqDB search
MTSTLPNDNIKKTFGEQISNKLISEIIRDRIKLNKKRFHANDNISDFINPGELEILQREV
AEKVKDLLKSLVIDIDNDHNSQETAERVAKMYLQEVFKGRYHKRPNVTDFPNAKKLDEIY
TLGPISVRSACSHHMVPIIGDCWIGIKPGDKVIGISKFARVADWVFSRPHIQEEAVMILA
DEIEKLCEPKGLAILVKAKHYCMCWRGVKEPNTSMINSIVRGDFRHDTSLKQEFFELVKQ
QPNGMACY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacatctacattacccaacgataatattaagaagacttttggtgagcaaattagtaat
aaacttatctctgaaattataagagatagaataaagttaaataagaaaagatttcatgct
aatgataatatttctgattttattaacccaggtgaattagaaatacttcaaagagaggtt
gctgagaaagtaaaagatttacttaaatcactagttattgatattgataacgaccataat
tcccaggagactgctgaaagggttgcaaaaatgtatttgcaagaagtatttaaaggccga
tatcataaaagacctaatgtaaccgattttcctaatgcaaagaaattagatgaaatatat
actcttggcccaataagcgttcgttcagcttgctcccatcatatggtcccaattattggt
gattgctggattggaatcaagcctggagacaaagtaataggaatttctaagtttgcaaga
gtagctgattgggtcttttctaggcctcatattcaggaggaggctgtaatgatacttgca
gatgaaatagagaaactttgtgaaccaaaaggtcttgcaattcttgttaaagctaagcac
tattgtatgtgttggagaggagtaaaagagcctaatactagtatgataaattccatagta
aggggagatttcagacatgatactagcctcaaacaggaattctttgagttagttaaacag
caacctaatggaatggcttgttattga

DBGET integrated database retrieval system