KEGG   Prochlorococcus marinus MIT 9215: P9215_06541Help
Entry
P9215_06541       CDS       T00598                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9215_06541 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9215_06541 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9215_06541 (trpA)
Enzymes [BR:pmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9215_06541 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
576296..577135
Genome map
AA seq 279 aa AA seqDB search
MKDNKMQITKNEPLSKVDEKFSELKNSKKIALMPFIMAGDPNLEITSEILLKLQENGADL
IELGIPYSDPLADGPVIQVAASRALKSGTSLRKVIKLLESLKGKLNIPIILFSYLNPLLC
FGFEKFCEMASYAGVSGLIVPDLPLEEAYKFSKIVSNQSMDLILLVAPTTPFERMKQISN
HTKGFTYLVSVTGVTGERNKMENRVENLIAKLKEVNSNPIAVGFGISTPEHVVKVREWGA
DGVIIGSAFVKRISSSSEKDVVHHIGEFCKEMRLAADQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataacaaaatgcaaattactaaaaatgaacctttatctaaggtagatgaaaag
tttagtgagttaaaaaatagtaaaaaaatagctttgatgccttttataatggctggggat
cccaatcttgaaataacgtctgagatattattaaagttacaagaaaatggagctgacctt
attgaattaggtatcccatatagtgacccacttgcagatggtcctgttattcaagtagcg
gcctctcgagccttaaagtcaggtactagcttaagaaaagtaattaaacttttagagtct
ttaaaaggtaaattaaatattcccatcatccttttttcttacttaaatccattactatgt
tttggctttgaaaagttttgtgagatggcatcttatgctggagtttctggattaatagtt
cctgatctccctttagaggaagcttataaattttcaaaaatagttagtaaccaatctatg
gacttgattttattagtagcaccaactactccttttgaaagaatgaaacaaatatcaaat
catacaaaagggtttacttatttagtaagtgttacgggggtcactggtgagagaaataaa
atggaaaatagagtggaaaatcttatagctaaattaaaagaagtaaatagcaatccaatt
gctgttggttttggaatatccactccagaacatgttgttaaagtgcgcgagtggggagca
gatggagtaattattgggagtgcttttgtaaaacgaatttctagttcaagcgaaaaagat
gtcgtccatcatattggtgaattttgtaaagaaatgcgtttagcagctgatcaaaaataa

DBGET integrated database retrieval system