KEGG   Prochlorococcus marinus MIT 9215: P9215_08831Help
Entry
P9215_08831       CDS       T00598                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9215_08831 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    P9215_08831 (proB)
Enzymes [BR:pmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     P9215_08831 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(770262..771344)
Genome map
AA seq 360 aa AA seqDB search
MKTWVIKIGTSILRGTEETSTEEVIETLSRSFTSFLSKGNKIILVTSGAVGLGCQKLNIE
TRPNDLSTLQATAAVGQVNLMSLYDKVFNKLGHNIAQILITKADFNSRKSFNNASKTLKK
LIDLNVIPIVNENDTVANEELKYGDNDTLSALVALAINANKLILLTDIENLYSKDPRNNN
DAQPIKEVHNSELKEIKDKNIKNSNNEWGTGGIATKLISAEIATKGGVEVQLVDGTNKKN
LIEIFNDNKIGTLFYPVEKPIRNKKSWLSHAIQTVGKITLDDGASFAIKRKGASLLAVGV
KDVEGNFTINQAVKIVNTNDKEVAKGLVSISSDKLRSILNNKENNNSSIIVVHRDVLALS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttgggttataaaaattggtactagtattttaagaggaacagaggaaacatct
acagaagaagttattgaaaccctttctagatcctttacaagttttctgtcaaaaggaaac
aaaataattttagtaactagtggagccgttggtttaggctgccaaaaattaaatattgaa
acgagaccaaatgatttaagtacccttcaagctactgctgcagtaggtcaagttaattta
atgtccttatacgataaggtatttaataaattaggtcataatattgctcaaatattaata
actaaagctgatttcaattcaagaaaatcatttaataacgcttctaaaactttaaaaaaa
ttaatcgatttgaatgttattccaatagtaaatgaaaatgatacagtagcaaatgaagag
cttaaatatggagataatgataccctctctgctttagttgccttagctataaatgctaac
aagcttattttattaaccgatattgaaaatctatactcaaaagatccacgtaataataat
gatgcgcaacctattaaagaagttcataatagtgaattaaaagaaattaaagataaaaat
attaaaaactcaaataatgaatggggaacaggaggaattgctacaaaactaatttctgcg
gagatagcaacaaaaggaggagttgaagtccaactagttgatggaactaataaaaaaaac
ttaattgaaatttttaatgataataaaattggaactttattttatccagtagaaaaacct
ataagaaacaaaaaaagttggctttctcatgcaattcaaacagtagggaaaattacttta
gatgatggagcttcttttgctattaaaagaaaaggtgcctcacttttagcggtaggtgtt
aaggatgtagaaggaaactttacgattaatcaggcagttaaaatcgtaaatacaaatgat
aaagaagttgcaaaaggtttagtatcaataagtagcgacaaattaagaagtatcttaaat
aataaagaaaacaacaattcctcgataattgtcgtacacagagatgttcttgctctctct
tag

DBGET integrated database retrieval system