KEGG   Prochlorococcus marinus MIT 9215: P9215_09271Help
Entry
P9215_09271       CDS       T00598                                 

Definition
glycoside hydrolase family protein (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P9215_09271
Enzymes [BR:pmh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     P9215_09271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
803060..804820
Genome map
AA seq 586 aa AA seqDB search
MKQIDSEKKLDRLKIDKLLKTIYTNNTTEEINFISNQLLQILSDFSEKSAYEEKRDKERW
NESHSVLITYADSIYKNGEATLTTLNELLSKHFGSLSKVVHILPFLKSTSDGGFAVSSYD
SLEEKFGSWDDLKSISKNHDLMADLVLNHVSSSHPWVQQFIKYQEPGISNVFSPKQNLDW
SNVVRPRSSSLFSQINTEDGPKQVWTTFGPDQIDLNWHNPKMTIEFLHLIINYLSNGIKW
LRLDAVGFIWKESGTTCLHLPKAHSIVKLLRVLLNNLLDEGVLITETNVPQKENLSYLIP
DDEAHMAYNFPLPPLLLEAIITSRADILNSWIFDWPILPEDTTLFNFTASHDGVGLRALE
GLMNEQRIKDLLINCEKRGGLVSHRRLSNGDDKPYELNISWWSAMEDSSRDAKRFQYERF
ILSQLLVMALKGVPAFYLPALLASENDIKSFSMTGQRRDLNREKFKLENLLAVLNNPESN
ANKNLKYLRNAMDVRSTLKQFHPCSQMKCLSKGRSDIVVIKRGKGLESVFAIHNMTENKI
NYQLNDNDLPKIIDNDFNAHDFLTSTKYNCKNISLAPFQVIWLNVL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaaattgattcagagaaaaaattagatagattaaagattgataaattgttaaaa
acaatttatacaaataatactacagaagaaattaattttatttcaaatcaattattacag
attttaagtgatttctcagagaaatctgcttatgaagaaaaaagagataaggagaggtgg
aatgaatctcattcggttttgataacttatgcggatagtatttataaaaatggtgaggca
acattaacaactcttaacgagttgttaagtaaacattttggcagtctttctaaagttgta
catattcttccttttttgaagtctacaagtgatggaggttttgcagtatcaagttatgat
tccttagaagaaaaatttggtagttgggatgatctcaaaagtatttctaaaaatcatgat
ttgatggctgatttagtactaaaccatgtttcatcatctcatccatgggttcaacaattt
attaaataccaagaaccggggatatcaaatgttttttcgccgaaacaaaatcttgattgg
tcaaatgtagttagaccaagaagttcctccttattttctcaaataaatactgaagatggt
cctaaacaagtttggacaacttttggtccagatcaaattgatttgaattggcataatcca
aaaatgacaattgaattcttacatttaattattaattatttatccaatggaattaaatgg
ttaaggcttgatgctgtaggttttatttggaaggaatcaggtacaacatgtttacattta
ccaaaagcacactcaattgtgaaactcttaagagttcttttaaataatcttcttgatgag
ggagttttaataactgaaactaatgttccccaaaaggaaaatctatcttatttgattcct
gatgatgaagcccatatggcatacaatttcccattgcctcctcttctcctcgaggcaatt
attacttcaagagctgatattctaaactcatggatttttgattggcccatattacctgaa
gatactactttatttaatttcactgcatcccatgatggtgttgggctaagagctcttgag
ggtttaatgaatgagcagagaattaaagatttactaattaattgtgagaaaagaggcgga
ttagtaagtcatagacgtttatcaaatggtgatgataaaccttatgaattgaatattagt
tggtggagtgcaatggaagactccagtagagatgccaaaagatttcaatatgagagattt
attttaagtcaattattagtaatggctcttaaaggtgtccctgcattttatttgccagca
ttactagcttcagaaaatgatatcaaaagtttttctatgacaggtcaaagaagagacctt
aatagagaaaaatttaaattagaaaatcttttagccgttttaaataatcctgaatctaat
gctaataaaaacttaaaatatcttcgcaatgctatggatgtcagatcaacattaaagcaa
tttcacccttgttcacaaatgaaatgtctgtctaaaggtagaagtgatattgttgtaata
aaaagaggtaaaggtctcgagtcggtttttgcaatccacaatatgactgaaaataaaatt
aattatcaattgaatgataatgatctaccaaaaataattgataatgatttcaatgcccat
gattttttaacatccactaaatacaattgcaaaaatattagtcttgctccttttcaagtg
atttggcttaatgttttataa

DBGET integrated database retrieval system