KEGG   Prochlorococcus marinus MIT 9215: P9215_09481Help
Entry
P9215_09481       CDS       T00598                                 

Gene name
ruvA
Definition
putative holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9215_09481 (ruvA)
Enzymes [BR:pmh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     P9215_09481 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(821856..822533)
Genome map
AA seq 225 aa AA seqDB search
MISWINGELVETWQTNQKFFVLINCQGLGYEIQILESFFLKLKTNQISNKKITLWIKHIK
KEDSDLLFGFTSKDQKFFFIEILSVRGVGSQIGMSILNKFSISEIIKAIKTQDKKLICSI
PGIGQKMSDRLILELKSKFKSKIQIEEEKGQEEFEITNPEIYKLMEDLQLTLQSLNYKNK
EIKTILPFLIKELGLPTKKEKNLSFENLLNLAMNHLDQGNSNLAR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttgattagttggataaatggagagttagttgaaacatggcaaactaatcaaaaatttttc
gttttaataaattgccaaggattaggatacgaaatacaaatactagaatccttttttctc
aaattaaaaacaaaccagatatctaataaaaaaatcactctttggataaaacatattaag
aaagaggattcagatttattatttggctttacatcaaaggatcaaaagtttttctttatt
gaaattttaagtgttcgaggtgttggatctcaaattggtatgagcatattaaataaattt
tctattagtgaaattatcaaagcaataaaaacacaagacaaaaaattaatttgttcaata
cctggtataggacaaaaaatgagtgatcggttaattttagaattaaaaagtaaatttaaa
agtaaaatacaaatcgaagaagaaaaaggtcaagaagaattcgagattacgaatcctgaa
atttataaattgatggaggaccttcaattaacccttcaatcattaaattataaaaacaaa
gaaataaaaactattttgccatttcttattaaagaattagggttacctactaaaaaagaa
aaaaatttatcatttgaaaatttattgaatttagctatgaatcatctagatcaaggtaat
agtaatttagctagatga

DBGET integrated database retrieval system