KEGG   Prochlorococcus marinus MIT 9215: P9215_10711Help
Entry
P9215_10711       CDS       T00598                                 

Gene name
chlH
Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
930157..934167
Genome map
AA seq 1336 aa AA seqDB search
MFTQVRSANRRVSPVEDNKHKVVIKAVYVVLEPQYQNSLTEAAKSINKMNGPIGIDLSGY
LIEELRNESNFEDFKGDIANADIFVASLIFIEDLAQKVVDAVSPYKDKLKASIIFPSMPE
VMRLNKLGSFSMAQLGQSKSIIGDLIKKKKESDGASFQDSMLKLLNTLPSILKYLPVEKA
QDARTFILSFQYWLGGTTENLKNFLLMISEKYAVSENIKDQIEEFKIQDPETFPDLGIWH
PLAPCMFESLEEYQNWENNRKDINPKHDKTPTIGLVLQRSHIVTGDEAHYVAVIQELEYR
GARVLPIFCGGLDFSKPVNEFYYDSINKDKPIVDGVVSLTGFALVGGPARQDHPRAIEAL
KRLNRPYMVALPLVFQTTQEWEDSDLGLHPVQVALQIAIPELDGAIEPIILSGRDDATGK
AHTLQDRVDVIAERAIKWSTLRVKQRKEKKLAITVFSFPPDKGNVGTAAYLNVFGSIYRV
LLEMKSKGYQIDELPSNSKELMEKVINNPEAMDGSPELNIAHKMSVKEYEEFTPYSRRLE
ENWGKPPGNLNSDGQNLLIYGKHFGNVFIGVQPTFGYEGDPMRLLYSRSASPHHGFAAYY
TYVEKIWGADAVLHFGTHGSLEFMPGKQMGMSETCYPDSLIGSLPNLYYYAANNPSEATI
AKRRGYASTISYLTPPAENAGLYKGLKELSELVGSYQQLRENSRGIQIVNAIVETSKQCN
LDKDVELPSKEVEELSIDERDLFVGNVYKQLMEIESRLLPCGLHTIGEAPTAEEAVATLV
NIASLEREQEGLRSLPGLLAESIGLTIEKIYDGNNKGELKFVELNEKIIKTARESIFAMV
NSLKIVDGRVYLEKSLLSKLFDLLKVFGLNLPTPWLRVCRLNGFNEVNQKKLNKLFDYLL
FCLEQVCADKEMDSLIKALDGNYVLPGPGGDPIRNPGVLPSGKNIHALDPQSIPTTAAVA
AAKSVVDKLIERQKEEQGTWPETIACVLWGTDNIKTYGESLAQILWFVGVKPKPDSVGRI
NKLELIPLEELDRPRIDVVVNCSGVFRDLFINQMALIDQAVKLAAEADEPLEYNFVRKHS
LEQAEKEGTSIREASARVFSNASGSYSSNVNLAVENSTWEEENELQEMYLSRKTYAFNAD
NPGEMNQKREVFESVMKTADVTFQNLDSSEISLTDVSHYFDSDPTKLIKTLRDDGKEPSS
YIADTTTSNAQVRTLGETIRLDSRTKLLNPKWYEGMLKSGYEGVRELSNRLNYTLGWSAT
SGQVDNFVYEETNETFINDEEMRKRLMDLNPNSFRRIVGTLLEVNGRGYWETSDENIEQL
KELYQEVEDKIEGVKE
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgcaggtccgctcagcaaaccgcagagtatctcctgttgaggataacaaacac
aaagttgtaataaaagcagtttatgttgtccttgagccacaataccaaaattccttaacg
gaagctgcaaagtcaatcaataagatgaatgggccaataggtatagaccttagcggctat
cttatcgaagaacttagaaatgaaagtaactttgaagactttaagggagatatagctaat
gcagatatatttgttgcttccctaattttcattgaagatctagctcaaaaagttgttgat
gcggtatctccatataaagataagcttaaagcctcaattatttttccatctatgccagag
gtaatgagattaaataagttaggttcatttagtatggcccaacttggacaatctaaaagt
attattggagatttaataaaaaagaaaaaagaatctgatggagcaagcttccaagactca
atgttgaagttattaaatacacttccttcaatacttaaatatctaccagtagaaaaagct
caagatgcaaggaccttcattctgagtttccagtactggttaggtggtactactgagaac
ttaaaaaacttcttattaatgatttctgaaaagtacgcagtttcagagaacataaaagat
caaatagaagaattcaaaattcaagaccctgaaacatttccggatttaggaatttggcac
cctctcgcgccttgcatgtttgaaagtcttgaagaatatcaaaattgggagaataatagg
aaagatataaatcctaaacatgacaaaactccaacgataggtttagtacttcaaagaagt
catatagttacaggggatgaagctcattacgttgccgtaattcaagaattggaatatcga
ggcgcgagagtacttccaatcttctgtggggggctagatttttctaaaccagttaatgag
ttttattatgattccataaataaagataagcctatagttgacggagtagtatctctaact
ggatttgcattagttggtggaccagcaagacaagatcatcctagagctattgaagctctt
aaaaggttaaatagaccatatatggttgcacttccattagtcttccaaaccacgcaagaa
tgggaagatagtgatcttggtttacacccagttcaggtagcacttcaaattgcgatccct
gagcttgatggtgctattgaacctattattctctcaggtcgtgatgatgctacaggaaaa
gctcatacactacaggatagagttgatgtaatagctgaaagagcaataaaatggtcaact
ttaagggttaaacaaagaaaggaaaaaaaattagctattacagtatttagttttcctcca
gacaaaggaaatgttggtacagctgcataccttaacgtttttggctcaatttacagagtt
cttcttgaaatgaaatcgaaaggatatcaaatagatgaactaccaagtaattcaaaagaa
ttaatggaaaaagtaataaacaaccctgaagctatggatggctctccagagttaaatatt
gctcataagatgtcagtaaaagaatacgaagaattcacaccatactcacgaagacttgaa
gagaattggggtaaacctcctggcaacctaaatagtgacggacaaaaccttcttatctat
ggaaaacattttggaaatgtttttataggagttcaacctacattcggttatgaaggtgat
cccatgagattactctactcaagaagtgctagtcctcatcatggttttgccgcttattac
acttacgtagaaaaaatctggggggctgatgctgttcttcattttggaacacacggctcc
cttgaatttatgcctgggaaacagatgggcatgagtgaaacttgctatccagattctctc
attggatcattgcctaatttgtattactatgctgcgaataatccatctgaagcaacaatt
gcgaagagaagaggatatgcttcaactattagttatctgactcctccagcggaaaatgca
ggcctatacaagggacttaaagaactaagtgaacttgttggttcttatcaacaattaaga
gaaaatagtagggggattcaaattgttaatgcaatagttgagacttctaaacaatgtaac
cttgacaaagatgtagagctcccttcaaaagaagtagaagagctttcaatagatgaaaga
gatttatttgttggtaatgtctataaacagttgatggaaattgagagtagattgttacct
tgcggtcttcatactattggagaagctccaacagcagaagaagctgttgcaacacttgta
aatattgcatctttagaaagagaacaagagggattaagatctcttcctggattactcgca
gaatccatcggtctaactattgaaaaaatttatgatggtaacaataaaggtgaacttaaa
tttgtagagttaaatgaaaaaatcataaagacagcaagagagtcgatttttgcgatggtc
aactctttaaaaattgttgatggcagagtttatttagaaaaatctcttctttcaaaactt
ttcgatttacttaaagtttttggtctaaatctacctaccccttggctaagagtctgcaga
ttaaatggatttaatgaagttaatcagaagaaattaaataaattatttgattacttactt
ttctgtcttgaacaggtctgcgcagacaaagaaatggatagcctcattaaagcattagat
ggaaattatgttttacctggaccaggtggagatcccataagaaatccaggtgttttgcct
agtggtaaaaatatccatgcacttgatcctcaatcaatcccaactacagcagcagtagct
gcggcgaagtctgttgttgacaaattaattgaaagacaaaaggaagagcaaggaacatgg
cctgaaacaatagcttgtgttttatggggtactgataacatcaaaacttacggagaatca
ctggcacaaatcttatggtttgttggggtaaaaccaaaaccagattctgttggaagaatt
aataaactagaattaatccctttagaagaattagataggccaagaatagatgtagtagtt
aactgttcaggagtatttagagatctatttattaatcaaatggcattaatagatcaggca
gtaaaattagcagctgaagctgatgaaccattggaatataattttgtaaggaaacattca
ctagaacaagcagaaaaagaagggacttctatcagagaagcttcagcgagagtattctct
aatgcaagtggaagttacagttcaaatgttaatttagccgtagaaaattcaacatgggag
gaagaaaatgaattacaagaaatgtatttatcgcgcaaaacatatgcttttaatgcagat
aatccaggtgagatgaatcaaaaaagagaggtatttgagtcagtaatgaaaacagcagat
gttacatttcaaaaccttgattcttcagagatttcattaacagatgtaagtcattatttt
gattcggatccgacaaaattgatcaagacattaagagatgacggaaaagaaccaagtagt
tacatagcggatacaactacttctaatgctcaagttagaacactaggagaaactatcaga
ttagactcaagaacaaaacttttaaatccaaagtggtatgaaggtatgctcaaatcaggc
tacgaaggagttagagaactttctaacagacttaattacactcttggttggagtgccaca
agtggtcaagtagataattttgtatatgaagaaactaatgaaacatttataaatgacgaa
gagatgaggaaaagattaatggatcttaatcctaatagtttcagaagaattgtaggaact
ttgctagaagtcaatggtaggggatattgggaaacttcagatgagaatatagaacagttg
aaagaactataccaagaggtagaggataaaatcgaaggtgttaaagaataa

DBGET integrated database retrieval system