KEGG   Prochlorococcus marinus MIT 9215: P9215_10721Help
Entry
P9215_10721       CDS       T00598                                 

Gene name
folP
Definition
putative dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    P9215_10721 (folP)
Enzymes [BR:pmh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     P9215_10721 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(934176..935030)
Genome map
AA seq 284 aa AA seqDB search
MRELQIINKNNPWPKGWGQKTSIMGVINLTPDSFSDGGELNSSKKVLDQVNHFLSNGVDV
IDLGAQSTRPGAEEVGFNIEIKRLIPYLKLIKSEFPDVLISIDTFNSEVAYEALLNGANW
INDVTGGRRDIKILDVVSKFNCPFVITHSRGNSQNMNELSNYQNVLTDVKCSLDNLIKNA
LEKKISERNIIVDPGIGFSKDIIHNLEILRNLDVFKKWNLPILIGASRKRFIGEILNEKN
PKERDIGTLAISCLCSQFNIDIVRVHNVKLNYQILKVADKIYRK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagaattgcaaattataaataagaataatccatggccaaaaggctggggccaaaaa
acttcaattatgggagttattaatttaactcctgattcatttagtgatggtggggaatta
aactcttcaaaaaaagttttagatcaagtaaatcatttcttaagcaatggtgttgatgtt
attgatcttggtgctcaaagtacgagacctggggctgaagaagttggatttaatatagaa
ataaaaagattgatcccatatctaaaattaataaaatctgaatttccagatgttttaatt
tctattgatacttttaattctgaggtagcttatgaagctcttttaaatggtgctaattgg
ataaatgatgtcactggaggaagaagagatataaaaattttggatgttgtatcaaaattt
aactgcccattcgtcataactcatagtcgtggtaatagtcaaaatatgaatgaactttct
aattaccagaatgtattgactgatgttaagtgctcgcttgataatttaataaagaatgct
ttagaaaaaaaaatatctgaaagaaatataatagttgatcctggaattggtttttcaaag
gatattattcataatttggaaatcttgagaaacttagatgtatttaaaaaatggaatttg
ccaattttgataggtgcatctagaaagagatttattggagaaattttaaatgagaaaaac
ccaaaagaaagggatataggaacacttgcaataagttgtctttgttctcagtttaatatt
gacattgtgagagttcacaacgtcaaacttaattatcaaatcctgaaagtagctgataag
atttaccgaaaataa

DBGET integrated database retrieval system