KEGG   Prochlorococcus marinus MIT 9215: P9215_10731Help
Entry
P9215_10731       CDS       T00598                                 

Gene name
tpi
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00010  Glycolysis / Gluconeogenesis
pmh00051  Fructose and mannose metabolism
pmh00562  Inositol phosphate metabolism
pmh00710  Carbon fixation in photosynthetic organisms
pmh01100  Metabolic pathways
pmh01110  Biosynthesis of secondary metabolites
pmh01120  Microbial metabolism in diverse environments
pmh01130  Biosynthesis of antibiotics
pmh01200  Carbon metabolism
pmh01230  Biosynthesis of amino acids
Module
pmh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9215_10731 (tpi)
   00051 Fructose and mannose metabolism
    P9215_10731 (tpi)
   00562 Inositol phosphate metabolism
    P9215_10731 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9215_10731 (tpi)
Enzymes [BR:pmh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P9215_10731 (tpi)
Exosome [BR:pmh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P9215_10731 (tpi)
  Exosomal proteins of bladder cancer cells
   P9215_10731 (tpi)
  Exosomal proteins of melanoma cells
   P9215_10731 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM FTZ
Motif
Other DBs
NCBI-ProteinID: ABV50688
CyanoBase: P9215_10731
UniProt: A8G507
Position
complement(935005..935730)
Genome map
AA seq 241 aa AA seqDB search
MRKSVIAGNWKMHMTCAEAKSYLEEFIPLIKNIKDDRKVVIAPPFTAISTFSNHSDFDYL
DISSQNIHWEDQGAFTAEISPKMLLEHGVSYAIVGHSEPRKYFSESDEQINKRAVFAQSS
GLTPIVCVGETLEQRERGEADRIITRQVEQGLENTDPSNLIVAYEPIWAIGTGKTCEAED
ANKICSLIRKLIGFDDVIIQYGGSVKPNNIDEIMSMSDIDGVLVGGASLDPNSFARIANY
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaatctgtaattgctggtaattggaaaatgcacatgacttgtgctgaagctaaa
tcctatttagaagagtttattcctttaataaaaaacataaaagatgatcgtaaagttgtt
attgcgccaccttttacggctatttcaaccttttcgaatcattctgattttgattattta
gatatttctagtcaaaatattcattgggaagatcaaggagcatttactgcagaaatatct
ccaaaaatgcttcttgaacatggtgtctcatatgcaatcgttggacatagtgaaccaagg
aaatattttagtgaaagtgatgaacaaattaataaaagagcagtttttgctcaatctagt
ggacttactccaatagtttgtgtaggagaaacattagaacaaagagagagaggagaagct
gatagaattattactagacaggttgaacaaggattagaaaatacagatccatctaattta
attgttgcctatgaaccaatatgggctattggcactggtaaaacatgtgaggctgaagat
gctaataagatatgttctttgattaggaaattaataggttttgatgatgtaattattcaa
tatggaggatctgttaaacctaataatattgacgaaatcatgtcaatgagtgatatagat
ggggtgttagttggaggggcttcattagatcctaatagttttgcgagaattgcaaattat
aaataa

DBGET integrated database retrieval system