KEGG   Prochlorococcus marinus MIT 9215: P9215_11791Help
Entry
P9215_11791       CDS       T00598                                 

Gene name
rbsK
Definition
(RefSeq) putative pfkB family carbohydrate kinase
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P9215_11791 (rbsK)
Enzymes [BR:pmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     P9215_11791 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(996259..997125)
Genome map
AA seq 288 aa AA seqDB search
MTVEKKNKFEEYKFEKGNLNFAVVGHVEWINFLRVDKLPKPGTISHSKKSIEYPAGGGSI
IAKILSDLTLNQIHFFTSLGNDDYGDKCFKILSNMGIKLHVAWRDKPTRRGFSLIDSQGE
RAITVIGERLAPTHKDKLDWNILKKMDGIFITASDSEIFKIARSASILCTTPRVGLNIIN
KSNVTLDGLIGSNLDPGEFFSFSELSLKPKFTIKTEGEKGGIIFPGGRYKALKNKKLKVD
SYGCGDSFAAGILYGMASKWDIDKSLNLAKVMGRDASEFFGPYANNYK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgaaaagaaaaataaatttgaagaatataaattcgaaaaaggtaatttaaat
tttgctgtagttggccatgttgagtggattaatttcttaagagtcgataaattgccgaag
ccaggaaccatctctcattctaaaaagtccattgaatatccagctggcggtggatctatt
atcgcgaaaatactttcggatttaactttaaaccaaattcatttttttacgtcattaggt
aatgatgattatggagataagtgtttcaagattctctcgaatatgggaattaagttgcat
gtggcttggcgtgataaaccaacgagaagaggatttagtttaattgactctcaaggtgaa
agagctataacagttattggagaaaggttagctccaactcataaagacaagttagattgg
aacattttaaaaaaaatggatggaatttttattactgcatctgattcagaaatttttaaa
attgctagatcagcttcaattctatgcacaacaccaagagtgggattaaatataattaat
aaatcaaatgtcactttagatggattaataggcagtaatcttgatcccggagaatttttt
tctttttctgaattatccttaaaacccaaatttactattaaaaccgagggagagaaggga
ggaataatatttcctggtggaagatataaggctctaaaaaataaaaaattaaaggttgat
tcttatggatgtggcgattcttttgctgctgggattctttatggaatggcatctaaatgg
gatatagataaaagtttaaatcttgctaaagtaatgggaagagatgccagtgaatttttt
ggcccatatgcaaataattataaataa

DBGET integrated database retrieval system