KEGG   Prochlorococcus marinus MIT 9215: P9215_11901Help
Entry
P9215_11901       CDS       T00598                                 

Gene name
chlI
Definition
protoporphyrin IX magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9215_11901 (chlI)
Enzymes [BR:pmh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     P9215_11901 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(1006091..1007179)
Genome map
AA seq 362 aa AA seqDB search
MPTTKKRRVFPFTAVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPA
IDVVKDDPYNSSLVDPDLQSKEVLEKITQGENLESIQKQVPMVDLPLGATEDRLCGTIDI
EKALSEGVKAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGVSVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVKTVRDAELRVQVVDQRTSFDDNPDEFSLN
VEKQQDELQQKVIKAQEILNSVQMDDDLRLNISAICGELDVDGLRGDIVTNRSARAIAAF
EGRTEVQEDDIARVISCSLRHRLRKDPLEQVDSGERVIQAFCKIFDLDEKENLSKFQLSA
EA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgcctacaacaaagaaaagaagagtttttccttttacagcagtaattggtcaagaagaa
atgaaattagctctcttgttaaatgttattgatccaagaataggaggagtgatgataatg
ggtgatagggggactggaaagtctactacaatcagagccttagctgatttgttgccagca
atcgatgttgttaaagacgatccatacaatagttcactagtcgatcctgatttgcaaagt
aaagaagttttggaaaaaattactcaaggagaaaatttagaaagtattcaaaaacaagta
cctatggttgacttgcctttaggggctactgaagacaggctttgtggaacgattgatata
gagaaggctttgagcgaaggtgttaaggcattcgaaccaggtctattagcaaaagccaat
aggggtttactatacgttgatgaagtgaatttacttgatgatcatttagttgatgtactt
ttagattcggccgcttccggatggaatacagttgaaagggagggtgtctcagttcgacat
cctgctaggtttgtccttattggttcaggaaatccagaagaaggtgaattaaggcctcaa
ctattggacaggtttggaatgagtgttgaagttaagacagttagagatgctgaattaaga
gttcaagtagtagatcaaagaacttcttttgacgataatcctgatgagttttcattgaat
gttgagaagcaacaggatgaacttcaacaaaaggttattaaagcacaagaaatattaaat
tctgttcaaatggatgatgacctaagattgaatatctctgcaatctgcggggaactagat
gttgatggtttacgtggagatattgttacaaataggtctgcaagagcaatcgcagccttt
gaaggcagaactgaagtacaggaagatgacattgcaagggttatttcttgttctttaaga
catagactaagaaaagatccccttgaacaagttgattcaggcgaaagagtcattcaagct
ttttgtaaaatattcgatttagatgaaaaagaaaatctttcaaaattccaattgtctgca
gaagcttaa

DBGET integrated database retrieval system