KEGG   Prochlorococcus marinus MIT 9215: P9215_12171Help
Entry
P9215_12171       CDS       T00598                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P9215_12171 (malQ)
Enzymes [BR:pmh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     P9215_12171 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1033301..1034776
Genome map
AA seq 491 aa AA seqDB search
MHPSCIPGGRVCGTFGKGAKDWIKKLSSYGIEYWQILPLTPTDSTGSPYSSPSSFALNPW
FLDIDYLIKEGYIFVSNLEELGPTYQNKDHFDFDTANNLYKKLGHLLLKGWSYQSEERKN
DFNKWIENNSWVEDYATFVVIREEFNMLPWWQWPKEFKIKNNEFLGSWINTNSEKILIEK
LIQWHLDEQWSAIKKFAKLYNVKLIGDLPFYVSRDSADVWSNKSLFSIFKNGDLIFQSGV
PPDYFSSTGQLWGTPTYFWSKHKNTNFDWWRKRFKRQFELMDLLRLDHFRGLAGYWRVNG
NSKTAISGRWINSPGRTLLNKLKIDLGTDFLPIIAEDLGLITPDVEKLRKIFELPGMKIL
QFAFNGDEDNPYLPKNIEGENWVVYTGTHDNSTSISWWECLEKNDKIRLKDEYKFSEDPS
WSLIKIGMETNANLFIAPIQDILSLDDSSRLNIPGTVKNNWKWKLNRTLDEIEDNIKRFS
DLGNSFGRIRK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcatccttcgtgtataccagggggaagagtatgtggaacttttggtaaaggggctaaa
gattggataaaaaagcttagtagctatggtatcgaatactggcaaattttacctcttaca
ccaactgattcaactggttcaccatatagttcaccgtctagctttgctctgaatccatgg
tttcttgatatagattatttaataaaagaaggttatatcttcgtttctaatttagaagaa
ttaggacctacttatcagaataaggatcattttgattttgatactgctaataatttatac
aaaaaattaggtcacctcctattgaaaggttggagttaccaatctgaagagagaaaaaat
gattttaataaatggattgaaaataattcatgggtcgaagattatgcaacatttgttgtt
atcagagaggaatttaatatgttaccttggtggcaatggcctaaagaatttaaaataaaa
aataacgaattcttaggatcatggattaatacaaatagtgaaaaaatacttattgaaaaa
ttaatacagtggcacttagatgagcaatggagtgctattaaaaaatttgcaaaattatac
aatgtcaagttaattggagatctacccttctatgtttctagggacagcgctgacgtatgg
agtaataaatcactgttttcaatttttaaaaatggagatttaatctttcaaagcggtgtg
cctcctgattatttttcatcaacagggcaactatggggaactccaacttacttttggtcc
aaacataagaatactaattttgattggtggagaaaaagatttaaaaggcaatttgaactt
atggacttgttgagattagatcatttcagaggtttggctggttactggagagtcaatggc
aattctaaaacagcaatttctggtagatggataaattctccaggaagaactctattaaat
aaactaaaaattgatttagggactgacttcctaccaataatcgcggaggatctgggatta
ataacacctgatgtagaaaaattaaggaaaatttttgaacttccagggatgaaaatatta
cagttcgcttttaatggggacgaagataacccatatttacctaagaatattgaaggagaa
aattgggtggtttatacaggtacacatgataactctacttccatctcatggtgggaatgt
ttagaaaaaaacgacaagatacgattaaaagatgaatataaattctctgaagatccctca
tggagtttaataaagataggtatggagacaaatgccaatctatttattgctccaatccaa
gatattttatctctagatgactcaagcagattaaacatacctggtaccgtcaaaaataat
tggaaatggaagttaaatcgaaccttagatgaaatagaagacaatattaagagatttagt
gatctaggaaatagttttgggagaattagaaaatag

DBGET integrated database retrieval system