KEGG   Prochlorococcus marinus MIT 9215: P9215_12381Help
Entry
P9215_12381       CDS       T00598                                 

Gene name
recD
Definition
exodeoxyribonuclease V 67 kD polypeptide (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9215_12381 (recD)
Enzymes [BR:pmh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     P9215_12381 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(1056396..1058099)
Genome map
AA seq 567 aa AA seqDB search
MTKTTTDIEKFQYDHIFNLILGIFKFSKKKYGNFVKDVIRILLEFEKNGETIIDVDNSFI
IFELLEDGWPNKHIDVLKNIGLIGSLHSPFVLVNRKLSLSKWSKKTERVINSFLKKIDTD
NLMKSIIYKDDNKIDQIKNIFKYSNLVFLQGGPGTGKTTLIIKLILELLQIDNFLNIGLS
APTGKATARLKEALNDKKNISFSKFLDQIEFQTLHRWILNSQNKSLKLKFKLKELDIFII
DEMSMVNIDLIESVLNLLAEDCKIILIGDKNQLSPVNNCSIWNYLFEYSDNSSIKSCVVN
LEKTYRNIGDIALISSLIFNNDYSLFNHKMKELEKDNNSKEITISKSREKDIPKDLLFSI
TSHLKQLNISTSNLSKKKYIFEESIDNLLLNEKDLVYKIFLDLQSHLILCEKNSGIWSVE
YLNEIVFGQKKPYDLKTLKEGVPIMCTKNNNELGLSNGDIGVLIGLKNKRKYLFRKFNDN
NEEIVTLIDPSNLENVVPAIAITIHKSQGSESEKVNILWSQNYRRNQYAVKEKKDNQNIF
CKDNFERRLFYTAVTRAKKSLNIYYLN
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaactactacagatattgaaaagttccaatacgatcatatatttaatttaatc
ttaggtattttcaaatttagtaaaaaaaaatatggaaatttcgtaaaagatgtaataaga
attcttttagagtttgaaaaaaatggtgaaactattattgatgttgataatagttttata
atctttgaattattagaagatggctggcccaataaacatatagatgttctaaaaaatata
ggtttgattggttcccttcattcaccattcgtattagtaaatagaaaattatccttatca
aaatggtcaaaaaagacagaaagagttattaattcatttctaaaaaaaatagataccgat
aatttaatgaaatcaataatttataaagatgataataaaattgatcaaattaaaaatata
tttaaatattcaaacttagttttccttcaaggaggaccaggtacgggtaaaaccacttta
ataataaagttaatactagaactccttcaaattgataactttttaaatattggtttatct
gctccaactggaaaagctacagctcgtttaaaagaagctcttaatgataaaaaaaatatt
tcttttagcaaatttctagaccaaatagaatttcaaactttgcatagatggattttaaat
tctcaaaataaatctcttaagttgaaattcaaactaaaagagcttgatattttcataatt
gatgaaatgtcaatggttaatatcgatttgattgaatcagttttaaatttgctagcagag
gactgtaaaattattttaattggagataaaaatcaattgtctccagtaaataactgttct
atatggaattatttgtttgaatattccgacaatagttcaataaaatcatgtgtagtaaat
ttagaaaaaacttatagaaatattggagatatagcattaattagtagtttaatatttaat
aatgattattctttatttaatcataagatgaaagaattagaaaaagataataattcaaaa
gaaattactatttcaaagagtagagaaaaagatattccaaaagatctattattttcgatt
acaagtcatctaaaacagttaaatatttcaacttcaaatttaagtaaaaaaaaatatata
tttgaagagagtattgataatttattgcttaatgaaaaagatttagtatataagatattt
ctggatttacaaagtcacttgattttatgtgaaaaaaattctggaatatggagtgttgaa
tatttgaatgaaattgtttttggtcaaaaaaaaccctatgaccttaaaactcttaaagag
ggtgtaccgattatgtgtacaaaaaataataatgaacttggattgtcaaatggggatatc
ggagtacttataggtttaaaaaataaaagaaaatatctttttagaaaatttaatgataat
aacgaagaaattgtaacattaattgatccatctaatttagaaaatgttgtaccagcaata
gctattactattcataaatctcagggaagtgaatctgaaaaagtaaacatattatggtcc
caaaattatagaagaaatcaatatgctgtaaaagaaaaaaaagataatcaaaatatcttt
tgcaaagataattttgaaagaagattattttatactgctgttacaagagcgaaaaaatct
ttaaatatatattatttaaattaa

DBGET integrated database retrieval system