KEGG   Prochlorococcus marinus MIT 9215: P9215_14061Help
Entry
P9215_14061       CDS       T00598                                 

Gene name
cysQ
Definition
CysQ protein-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pmh00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(1196408..1197310)
Genome map
AA seq 300 aa AA seqDB search
MIKLPSGVDINNLIDDIRIFSWQAADILLYYSKLLEDSDGKRNILKNNNVNDPVTVADLK
VNELIIKRINEKYKNINWDILSEENVKISSKGFDSKTDWIWVLDPLDGTKDFIQGTGNYA
MHLALNFKQKTYIGFVLIPNKNQLWITDGKKTWCEKRDGTRYKPNLLKKNNLQEMTLVTS
KNHGNEILKNLIQKINFRKVEIMGSIGCKIASIIRGDSDIYICLSLPGKSSPKDWDFAAP
ESILKAAGGAVTNLDNQELTYGQTSFQQSGVIVATSNKDTHGSICLQIKKIIEDNAIYPL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgattaaattaccctctggtgtagatattaataatcttatcgatgatataagaattttc
agctggcaagcagcagatattttgctttattactctaaattgttagaagattcagacggt
aaaagaaatatactcaaaaataataatgtaaatgatccggttactgtggctgatttaaaa
gttaatgaattgattattaaaagaataaatgaaaaatataaaaatattaattgggatatt
ttgagtgaagaaaatgtaaaaatttcttcaaaaggttttgatagtaaaactgattggata
tgggttcttgatcctcttgatggaacgaaagatttcatccaaggaacaggtaattatgca
atgcatttggcattgaactttaaacaaaaaacatatattgggtttgttttgattccaaat
aaaaatcaattgtggataacagatggaaaaaaaacatggtgtgaaaaaagagatggcaca
agatataaaccaaatctcttaaaaaaaaataatcttcaagaaatgactttagttacaagt
aaaaatcatggaaatgagattttgaaaaatttaattcaaaaaattaattttcgcaaagtc
gaaatcatgggaagcattggttgcaaaattgcatctataattagaggagacagtgatatt
tatatttgtttaagtttaccggggaaaagctcaccaaaagattgggattttgctgcacca
gaatctattctaaaagcagctggaggagcagttacaaatttagataatcaagaattaact
tatgggcaaactagtttccaacaaagtggagttatagttgcgactagtaataaggataca
catgggagcatttgtctccaaataaagaaaattattgaggataatgcaatatatcctctt
tag

DBGET integrated database retrieval system