KEGG   Prochlorococcus marinus MIT 9215: P9215_19451Help
Entry
P9215_19451       CDS       T00598                                 

Gene name
ole1
Definition
Fatty acid desaturase, type 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    P9215_19451 (ole1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    P9215_19451 (ole1)
Enzymes [BR:pmh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     P9215_19451 (ole1)
Lipid biosynthesis proteins [BR:pmh01004]
 Desaturase
  First
   P9215_19451 (ole1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1685654..1686592
Genome map
AA seq 312 aa AA seqDB search
MNSVIFQETAKLKRPVPAEKVAELHYKFLAPSSHSKKYPPRLHKTWGTIVFMIAIHVLSL
VALQPQFWSLPAVTALFFFYWLTACLGVTLGYHRLLSHRSFVVPRWLERFFATCGAISCQ
HGPIDWVGLHRHHHSFSDTEVDHHNSKRGFWWSHMGWMFKDVEALKAVPKLSADLIKDPY
YRFLNKYFLFLQIPIGLTLYAIGQKLGVGGWAMVLWGIPLRLVVVYHITWLVNSATHCWG
EAPFESGDESKNNAWVAALTFGEGWHNNHHAFPNSARQGLFKGQIDLTWEHIKILAKLRL
AKKVKLPSRSYY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagtcatcttccaagaaacagcaaaattaaaaagacctgtacctgcagaaaaa
gttgcagagcttcattataaattcctagctccatctagtcactctaagaaatatcctcct
agattacataaaacatgggggactatcgttttcatgattgccatacatgtcttatctctt
gtagcattacaacctcagttttggagcttgccagcagttaccgccttatttttcttttac
tggttgactgcctgtctaggagtcacactaggttaccatcgtttactttcccatagatct
tttgttgttccaagatggttggaaagattctttgctacttgtggtgctatcagttgccag
catggtccaatagattgggttggcttacataggcatcatcattcattctcagataccgag
gtagatcatcacaacagcaagagaggcttttggtggagccatatgggatggatgtttaaa
gatgtagaagctcttaaagcagtacctaaattaagtgcagatttaattaaagatccatat
tacagattcctaaataaatatttcttatttttacaaattccaattggacttacattatac
gcaataggtcaaaaattaggtgttgggggatgggctatggtcttgtggggaataccttta
aggcttgtagtcgtttaccacattacttggttagtaaactcagccactcattgctgggga
gaggctcctttcgaaagcggtgacgaatcaaaaaacaatgcttgggtcgcagctttaaca
tttggagaaggatggcataataatcatcatgcatttcctaattcagcaaggcaaggatta
tttaaaggacaaattgacctaacttgggagcatattaagattcttgctaaattaagactt
gcaaaaaaagtaaaattaccctctaggtcttattattaa

DBGET integrated database retrieval system