KEGG   Prochlorococcus marinus MIT 9215: P9215_19451Help
Entry
P9215_19451       CDS       T00598                                 

Gene name
ole1
Definition
Fatty acid desaturase, type 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pmh01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pmh01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1685654..1686592
Genome map
AA seq 312 aa AA seqDB search
MNSVIFQETAKLKRPVPAEKVAELHYKFLAPSSHSKKYPPRLHKTWGTIVFMIAIHVLSL
VALQPQFWSLPAVTALFFFYWLTACLGVTLGYHRLLSHRSFVVPRWLERFFATCGAISCQ
HGPIDWVGLHRHHHSFSDTEVDHHNSKRGFWWSHMGWMFKDVEALKAVPKLSADLIKDPY
YRFLNKYFLFLQIPIGLTLYAIGQKLGVGGWAMVLWGIPLRLVVVYHITWLVNSATHCWG
EAPFESGDESKNNAWVAALTFGEGWHNNHHAFPNSARQGLFKGQIDLTWEHIKILAKLRL
AKKVKLPSRSYY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagtcatcttccaagaaacagcaaaattaaaaagacctgtacctgcagaaaaa
gttgcagagcttcattataaattcctagctccatctagtcactctaagaaatatcctcct
agattacataaaacatgggggactatcgttttcatgattgccatacatgtcttatctctt
gtagcattacaacctcagttttggagcttgccagcagttaccgccttatttttcttttac
tggttgactgcctgtctaggagtcacactaggttaccatcgtttactttcccatagatct
tttgttgttccaagatggttggaaagattctttgctacttgtggtgctatcagttgccag
catggtccaatagattgggttggcttacataggcatcatcattcattctcagataccgag
gtagatcatcacaacagcaagagaggcttttggtggagccatatgggatggatgtttaaa
gatgtagaagctcttaaagcagtacctaaattaagtgcagatttaattaaagatccatat
tacagattcctaaataaatatttcttatttttacaaattccaattggacttacattatac
gcaataggtcaaaaattaggtgttgggggatgggctatggtcttgtggggaataccttta
aggcttgtagtcgtttaccacattacttggttagtaaactcagccactcattgctgggga
gaggctcctttcgaaagcggtgacgaatcaaaaaacaatgcttgggtcgcagctttaaca
tttggagaaggatggcataataatcatcatgcatttcctaattcagcaaggcaaggatta
tttaaaggacaaattgacctaacttgggagcatattaagattcttgctaaattaagactt
gcaaaaaaagtaaaattaccctctaggtcttattattaa

DBGET integrated database retrieval system