KEGG   Prochlorococcus marinus MIT 9215: P9215_19591Help
Entry
P9215_19591       CDS       T00598                                 

Gene name
speB
Definition
arginase family (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    P9215_19591 (speB)
Enzymes [BR:pmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     P9215_19591 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1700064..1700945
Genome map
AA seq 293 aa AA seqDB search
MTKNLFDNENAIYIGAKRNPENCSIGIFGVNYDGTCSFKPGARFGPEAIRQVSSCLETYC
PKIKKDLEDILYVDFGSILIDKNDSKSVIESVKSATNYLISKRLSPIMLGGEHSITRGAI
EALVKKYPDLILIQLDAHADLRESYIGNEHSHACTMKRCLEVLPEKKILQVGIRSGTKEE
FEIMHSNHQLVNFCPGGNAHELKQALLPYAKSPIYLTIDLDWFDPSLLAGTGTPEPGGFF
WNDFEEILKTLKDLRIVASDIVELSPEIDKSGVSSIVAAKVLRSLILSLENMQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaatttatttgataacgaaaatgcaatttatattggagcaaaaagaaatcct
gagaattgctcaattggtatatttggagttaattatgacgggacatgttcgtttaaacca
ggagcaagatttggtccagaagcaataagacaagtcagttcttgtttagaaacatattgt
ccaaaaataaaaaaagacttagaggatattttgtatgttgattttggatcaatactaatt
gataaaaatgactcaaagtccgttattgaatcggttaaatcagcaacaaattatttaatt
agtaaacgccttagtcctattatgcttggaggggaacactctattacaagaggtgctatt
gaagcattagtaaaaaaatacccagatttgatattgattcaacttgatgctcatgcagat
ttaagagaatcatatatagggaacgaacatagtcatgcttgtactatgaaaagatgctta
gaagtgctacctgaaaaaaaaattttgcaagtaggaattagaagtgggactaaagaagaa
tttgaaattatgcatagcaaccaccaattagttaacttttgtccaggcggaaatgcacat
gagttaaaacaagctcttctaccatacgctaagtctccaatctatttaacaatagattta
gattggtttgatcctagtttactagcagggacgggtactccagaaccgggaggatttttt
tggaatgattttgaagaaatactaaaaactttaaaagaccttagaattgtggcttcagat
attgtggaattatctccagaaattgataaaagcggagtaagtagcatagttgcagccaaa
gtacttagaagcttaattttgtcattagaaaatatgcaataa

DBGET integrated database retrieval system