KEGG   Prochlorococcus marinus MIT 9215: P9215_19881Help
Entry
P9215_19881       CDS       T00598                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9215_19881 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9215_19881 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P9215_19881 (thrC)
Enzymes [BR:pmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P9215_19881 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1737519..1738622
Genome map
AA seq 367 aa AA seqDB search
MVLLNKIKNKLRINYRKKRWPGLIEAYKQYLPVTKKTPIISLNEGNTPLIFSNSISKLIG
NGTKVFLKYDGLNPTGSFKDRGMTMAISKAKEEGCESVICASTGNTSAAAAAYASRGGLK
PYVLIPEGFVAQGKLAQALMYGAEIISINGNFDKALEIVRDLSSEHPVELVNSVNPYRIQ
GQKTAAFEIVDDLGISPDWLCIPMGNAGNITAYWMGFKEYSKIKSNLKLPIMMGFQSEGS
APLVKNIIVKDPETIATAIRIGNPVNREKAKIVRKESKGDFQSVTDEEIINAYKILAKEG
VFCEPASAASVAGLIKNKNRIQKESTIVCVLTGNGLKDPDCAIKNNDAIFRKNIEPSLKN
ITKILGY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgttattaaataaaataaaaaataaactgcgtattaattacagaaaaaaaagatgg
ccaggtctaatcgaagcttacaaacaatatcttccagttacgaaaaaaactcctattatt
tccctgaatgaaggaaatacgccactaatttttagtaattcaattagcaaactaattgga
aatggtacaaaagtttttttaaaatatgatgggctaaatccaacaggatcttttaaggat
cgtggtatgactatggcaattagcaaagcaaaagaagaaggctgtgagtcagtaatatgt
gcaagtactggaaatacttctgcagcagcagcagcatatgcttctagaggaggattaaaa
ccttatgttttaatcccagaaggatttgttgctcagggaaagcttgcacaagctttgatg
tatggagctgaaataatatctattaatgggaattttgataaagcacttgaaattgttaga
gatttatcctcagaacatccagtagaacttgttaattctgttaatccatatagaattcaa
ggacaaaaaacagctgcctttgaaatagttgatgacttaggtatttcccctgattggctt
tgtattccaatgggtaatgcgggaaatataactgcttattggatgggatttaaagaatac
tcaaaaataaaaagtaatttgaaattgccgattatgatgggctttcaatctgaaggctct
gctccattagtaaaaaacataatagttaaagatccagaaacaatcgcaactgcaataaga
attgggaatcctgtaaatagagaaaaagcaaaaatagttagaaaggagagtaaaggagac
tttcagtcagttacggatgaagaaataatcaatgcttataaaatccttgccaaagaagga
gtattttgtgaacctgccagtgcagcatcagttgctggactgattaaaaataaaaataga
attcagaaagaatcgactattgtttgtgttcttacaggaaatggattgaaagatcctgat
tgcgctataaaaaacaatgatgctattttcaggaaaaatatcgaaccttcattaaaaaat
ataactaaaatcttaggatattaa

DBGET integrated database retrieval system