KEGG   Prochlorococcus marinus MIT9312: PMT9312_0116Help
Entry
PMT9312_0116      CDS       T00297                                 

Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
115259..116056
Genome map
AA seq 265 aa AA seqDB search
MPIVDRPLDQRNIIITRSKEGILDIKKIFTSKGANIYEFPAISIGDPDDLDPLDEALNQI
NDFHWIIFSSSNGIKFVDKRLRYFQSSLKECSKKTKIAVVGEKTAQTLDDFGIKADFIPP
EYVAESLIDNFPISGYGLRVFLPRVQTGGRDLIADQFRKAGSRVFEVAAYETRCPDSIPE
ETIDIIVNRKVDAFIFSSGKTVSNSAVLLEKAFGKEWLKYLDQTRFLTIGPQTTKICKKI
FGRVDSQAQKYTFDGLLDVAISIFS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccaatagttgatcgaccccttgatcaaagaaatataattatcactcgatcaaaagag
gggatattggatatcaaaaagatattcacaagcaaaggcgctaatatatatgagtttcct
gcaataagtattggagatcctgatgatttagatcctcttgacgaagcgttaaatcaaata
aatgattttcattggattattttttctagtagtaatgggatcaaatttgttgataaaaga
cttagatattttcaaagttcattaaaggagtgttctaaaaaaacaaaaatcgctgtagtc
ggagaaaaaactgcacaaactcttgatgattttgggattaaggctgatttcataccccca
gaatatgttgccgaaagtttaattgataattttccaatatctggatatggacttcgagta
tttttgccaagagtccaaacaggaggaagggatctaattgcagatcaatttagaaaggct
ggttcgcgtgtatttgaggttgctgcgtatgaaactagatgtccggattcaatcccagaa
gagacaattgatattattgttaatcgaaaagtcgatgcatttattttctcaagtggcaaa
actgtatcaaattctgctgttttactagaaaaagcctttggtaaagaatggttaaaatat
ttagatcaaactaggttcttaactattggacctcaaacaacaaaaatatgtaaaaagatt
tttggcagagttgatagtcaggcacaaaaatatacttttgatggactactggatgtagca
attagtatttttagttag

DBGET integrated database retrieval system