KEGG   Prochlorococcus marinus MIT9312: PMT9312_0162Help
Entry
PMT9312_0162      CDS       T00297                                 

Definition
NADH dehydrogenase subunit H (EC:1.6.5.3)
Orthology
K05572  
NAD(P)H-quinone oxidoreductase subunit 1 [EC:1.6.5.3]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pmi00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(155685..156803)
Genome map
AA seq 372 aa AA seqDB search
MEYGLDLEYSFNEFFKGFGLSSEIAHIIWLPIPMLLVLVAAVVGVLVTVWLERKISAAAQ
QRIGPEYAGALGVLQPIADGLKLLVKEDIIPAKADGILFTAGPILVLVPVILSWLIVPFG
QNLLISNVGIGIFLWIALSSIQPIGLLMSGYASNNKYSLLGGLRAAAQSISYEIPLALSV
LAIVLMTNSLSTIDIVNQQSGAGILSWNIWRQPVGFIVFWICALAECERLPFDLPEAEEE
LVAGYQTEYAGMKFALFYLGSYINLILSALLVSILYLGGWGFPIPVELIAKFLHLPINAP
VIQVFTASIGIVMTVLKAYLLVFIAILLRWTTPRVRIDQLLDLGWKFLLPISLANLLITA
GLKLAFPQFFGG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttggaatacggattagatcttgaatatagttttaatgaattcttcaaaggttttggcctt
tctagtgaaatcgctcatataatttggctccctatacctatgcttttggttttagtagcg
gcagttgttggagttttagtaacagtttggcttgaaagaaaaatatctgctgctgctcaa
caaagaataggtcccgaatatgcaggagcattaggcgtactccaaccaattgcggatggt
cttaaattacttgtcaaagaggatataatccctgctaaagcagatggaattctcttcacc
gctggacctatattagttcttgttccagttattctttcttggctaattgtaccttttgga
caaaacctgttaataagtaacgttggcattggaattttcctatggattgctttaagcagt
atccaaccaattggactccttatgagcggttacgcatcaaataataaatattcattatta
ggcggattaagagctgctgctcaatctataagttacgaaatacctttagctttatctgta
ctagctatcgtactaatgacaaattctctaagtactattgacattgttaaccaacaaagt
ggtgctggaatcctaagttggaatatttggagacaacccgttggttttatagtcttttgg
atttgtgctcttgcagaatgcgaaagacttccatttgacttacctgaagctgaagaagaa
ttagttgcaggatatcaaactgaatatgcaggtatgaaattcgctttgttctaccttggt
agttacattaatctaatactttcagcattattggtatcaatactttatttaggaggatgg
ggttttcctatcccagttgaattaatagctaaatttcttcatttgcccattaatgcaccc
gtcatacaagttttcactgcatcaataggaattgtaatgactgtattgaaagcgtatctt
ttagttttcatcgcaatattattacgttggacaactcctagagtaagaatagatcaactt
ttagatctaggatggaagtttcttcttccaatttctcttgctaatcttttgataactgca
ggattaaaacttgcttttcctcaattctttggtggttaa

DBGET integrated database retrieval system