KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0166Help
Entry
PMT9312_0166      CDS       T00297                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMT9312_0166
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMT9312_0166
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMT9312_0166
Enzymes [BR:pmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMT9312_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(160050..161294)
Genome map
AA seq 414 aa AA seqDB search
MVSTFSRQDQNYKNDDLNQPSKEGRFGKYGGQYVPETLMPALFELETAASNAWKDKLFVK
ELNHLLKTYVGRETPLYEAKRLTEHYKTKHATTRIWLKREDLNHTGAHKINNALGQALLA
IRMGKKRIIAETGAGQHGVATATVCARFGMKCIIYMGAEDIKRQSLNVFRMKLLGAEVKV
VNSGTATLKDATSEAIRDWVSNVETTHYILGSVAGPHPFPKIVRDFHAVIGEETKKQCQE
SFGSLPDILLACVGGGSNAMGLFHPFIKETSVRLIGVEAAGSGVDTDKHAATITKGSVGI
LHGSMSLLLQDDNGQVQEAHSISAGLDYPGVGPEHSHLKDIGRAEYGSVTDQEALDALRL
VSELEGIIPALETSHAFAWLDKLCPTLEKDTHIVINCSGRGDKDVNTVASSLDI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagtacattttctcgccaagatcaaaattataaaaatgacgatttaaatcaaccc
tccaaagagggaagatttggaaaatatggtggtcaatatgttcctgaaacactaatgcct
gctctttttgagcttgaaacagctgcatcaaatgcatggaaagataaactttttgtaaaa
gaattaaatcatctacttaagacttatgtaggaagagaaacaccactttatgaagccaaa
agacttactgaacattacaaaactaaacatgcaactacaagaatatggctaaaaagagaa
gatttaaatcatacaggtgctcacaaaattaataatgcccttggacaagctttattagca
ataagaatgggtaaaaaaaggataatcgcagaaactggagcaggtcagcatggagttgct
acggctactgtttgtgccagatttggcatgaaatgtattatctatatgggtgctgaggac
ataaaaagacaatccctcaacgtctttagaatgaaactgctaggagccgaagttaaagtt
gtcaattctggaactgcaacacttaaagatgccactagtgaagctattagggattgggtt
tctaatgtcgaaaccacacattacattttaggatctgttgcgggcccgcaccctttccca
aaaattgtacgagattttcatgcagttataggagaagaaactaaaaaacaatgtcaggaa
tcgtttggatctttaccagatattttacttgcttgtgtaggtgggggatcaaatgcaatg
ggccttttccatcctttcattaaagaaacatctgtacgactaattggagttgaagccgca
ggaagcggagttgatactgacaaacatgctgcaactattactaaagggtcagttggaatt
ttgcatggatcaatgagtcttcttttacaagatgataatggtcaagtacaagaagcccac
tcaataagtgcagggttagattaccctggagtaggacctgaacatagccatttaaaagat
ataggcagagcagaatatgggtcagtcacagatcaagaagctttagatgctttgagactt
gttagtgaacttgaaggaattataccagcgcttgaaacgtcccatgcctttgcttggtta
gataaattatgccctactctggaaaaagatactcatatagttatcaattgctctggtaga
ggtgacaaagatgttaatactgttgcatcttcattagatatttaa

DBGET integrated database retrieval system