KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0254Help
Entry
PMT9312_0254      CDS       T00297                                 

Definition
(GenBank) photosystem II reaction centre N protein (psbN)
  KO
K02715  
PsbN protein
Organism
pmi  Prochlorococcus marinus MIT 9312
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
242760..242912
Genome map
AA seq 50 aa AA seqDB search
MQTLSSAPDPAVSVAVTILAILLALTGFGLWTAFGPKAAKLTDPWDEHDD
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttatcatctgcgccagatcctgcagtttccgtagcagtaacaattctggca
atacttctagctttaaccggttttggtctttggacagcatttggacccaaagctgcaaag
cttacagatccttgggatgaacatgacgattaa

DBGET integrated database retrieval system