KEGG   Prochlorococcus marinus MIT9312: PMT9312_0289Help
Entry
PMT9312_0289      CDS       T00297                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PMT9312_0289
Enzymes [BR:pmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PMT9312_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(277005..277571)
Genome map
AA seq 188 aa AA seqDB search
MELSNLNIKNGLCISLGANIDSKFGSPLESLLICKPKIEEIINEWGDHSNKKKEEKRKFH
ANFFWSSIYETLPHGVENEQPNYLNTLLLIKSNSFPKPSNKKAKLLLKELKKLERSFGRE
KTPKGKKWLSRCLDLDILWWEDFHTVDEELTLPHPRFMNRNFVITPLSEILSRSQKIKKF
DDPKWSIK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggaattatcaaatcttaatatcaaaaatggactatgtatatccctaggagcaaatatt
gatagtaaattcggaagccctcttgagtcactattaatttgcaaaccaaaaatagaagaa
ataataaatgagtggggcgatcattccaacaaaaaaaaagaagagaaaagaaaatttcat
gcaaactttttttggtcttcaatttatgagacattacctcatggagttgagaatgaacag
cccaattatttaaatactcttttgctcataaaaagtaattcttttccaaaaccatcaaat
aaaaaggcgaaattacttttaaaagaactaaaaaagttagagagatctttcggaagagaa
aagacgccaaagggtaagaaatggctatcaagatgtctcgatttagatattctctggtgg
gaagattttcatacggttgacgaggaattaacattacctcaccctagattcatgaaccga
aatttcgttattacaccactatctgagatcttaagtagaagccaaaaaatcaaaaagttt
gatgacccaaaatggtctatcaaatga

DBGET integrated database retrieval system