KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0290Help
Entry
PMT9312_0290      CDS       T00297                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00860  Porphyrin and chlorophyll metabolism
pmi01100  Metabolic pathways
pmi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMT9312_0290
Enzymes [BR:pmi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMT9312_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase MCM VWA Sigma54_activat AAA_5 AAA_16 VWA_3 AAA_33
Motif
Other DBs
NCBI-ProteinID: ABB49351
CYORF: PMT9312_0290
UniProt: Q31CP4
Position
277620..279797
Genome map
AA seq 725 aa AA seqDB search
MILNPELTEKGEIKDLMKSKDSFRAFPLAAITGHSLLKLSLLLAAVDPSLGGVVIAGGRG
TGKSVLARGLHTLLPPIEVLDNELILEKLTKRNSNTSLRPIGRNLDPDKPEEWDISTNKL
LEEAIGSDYLNQIEEIPKKVREAPFIQVPIGITEDRLVGSIDVAASLSTGEQVFQPGILA
EAHRGVLYVDDINLLDDGIVNLILEATGREKNNIERDGLSLSHPCKSLLIATYNPEEGAL
RDHVLDRFAIVLSADQSIDNTQRVEITKSVLSHAENNIKFSEKWSEESDNLSTQLILARQ
WLKDVKITKEQITYLVNEALRGGVEGHRSELFAVKVAKANAALRGDENVNSEDLKVAVRL
VILPRAMQIPPEDEDIQPPPPEDQSPPPPPQSNNDDSEPEANENDNNQDQEQEEDNSDGE
EESTPEIPEEFILDPEACMVDPDLLLFSSAKAKAGNSGSRSVIFSDSRGRYVKPVIPRGK
VKRIAVDATLRAAAPYQKSRRLRNPNKSIVIEENDFRAKLLQKKAGALVIFLVDASGSMA
LNRMQSAKGAVIRLLTEAYENRDEVALIPFRGNQAEVLLPPTRSITAAKRRLETMPCGGG
SPLAHGLTQSAKVAKNALSTGDIGQVIVVAITDGRGNVPLGLSLGKNEVEEKDNENVNLK
QEVLDIAAKYPILGIKLLIIDTERKFIASGFGKELAEAARGKYVQLPKATDKAIAAMALN
AINEF
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgattttgaaccccgagttaacagaaaaaggagagataaaggatttaatgaagtcaaag
gattcttttagagctttccctttagctgcaattacaggtcatagcttattaaaattatct
ttgcttctagcagcagttgatcccagtttagggggagtggttatcgctggcggaagaggt
actggaaagtcagtattagcaaggggtttgcatactttactccctcctatagaggtatta
gataatgaattaatactggaaaagctaactaagagaaatagtaatacttcattaagacct
attggtaggaacctagatccagataaacctgaagaatgggatattagtactaataaattg
ttagaggaggcaattggaagtgattatttgaatcaaattgaagaaattccaaaaaaagta
agagaggcaccatttattcaagttcctattggcataactgaagacagacttgttggatca
attgacgttgctgcttcattaagtacgggggaacaagtttttcagcctggaattttggca
gaagctcatagaggtgttctttatgtagacgatataaatttattggatgatggtattgta
aatttaattcttgaagctacgggaagagagaaaaataatattgaaagagatggtttgagc
ctttctcatccttgtaagtcacttttaatagcaacttataatcctgaagaaggtgcttta
agagatcatgttttagatcgttttgcgattgtgctttccgcagatcaatctattgataat
actcaaagagttgagattacaaaatctgttttatcacacgcagaaaataatattaaattt
tcagaaaagtggtccgaagaatctgataatttatctactcaattaattttagcaaggcag
tggttaaaggatgtcaagataacaaaagagcaaataacctatttagtgaatgaggctctt
agaggaggcgtagaaggtcataggtcagaattgtttgcagtaaaagtagcaaaggcaaat
gcagctcttaggggtgatgagaatgtaaattctgaagacctaaaagtcgcagtaaggtta
gttatccttccgagagcaatgcaaataccacctgaagatgaagatatacaacctcctcct
ccagaggatcagagtcctcctcccccacctcaatcaaataatgatgactcggaacctgag
gctaatgaaaacgataataatcaagatcaagagcaagaagaagataattctgatggagaa
gaagaatctacccctgaaatacccgaagaatttatattagatcctgaggcatgtatggtt
gaccctgatttactgcttttttcatctgccaaagcaaaagcaggaaatagtggaagtaga
tcagtgatatttagtgacagtagaggaagatatgtaaagccagttattccaagaggcaaa
gtaaaaagaattgcagtagatgcaactcttcgagctgctgcaccttatcaaaaatcaaga
agattaagaaaccctaataaatcaatagttattgaagaaaatgattttagagcaaagctt
ttacaaaaaaaagcaggtgcattagttatttttctggttgatgcgagcggctctatggca
ttaaatagaatgcaaagtgccaaaggtgcagtaataagacttttgacagaggcatatgaa
aatagagatgaagtagctctaattccctttagaggtaatcaggccgaagttcttttacct
ccaacaagatctataactgcagcaaaaagaaggcttgaaacaatgccttgcggaggagga
tcacctttggctcatgggctaacacaatcagcgaaagtagcaaaaaatgctctttctaca
ggagatatcggtcaagttattgttgtggctattactgatggaagaggcaatgtaccctta
ggattgtccttaggaaaaaatgaggttgaagaaaaagataatgaaaatgtcaatttaaaa
caagaggttcttgatattgctgcaaaatatccgatacttggaataaaactcttaataatt
gatacagagagaaaatttattgcaagtggctttggtaaagaattagcagaggcagctaga
ggtaaatatgttcaattgccaaaagctacagataaagcaatcgcagctatggctttaaat
gctataaatgaattctga

DBGET integrated database retrieval system