KEGG   Prochlorococcus marinus MIT9312: PMT9312_0290Help
Entry
PMT9312_0290      CDS       T00297                                 

Definition
protoporphyrin IX magnesium chelatase subunit ChlD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMT9312_0290
Enzymes [BR:pmi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMT9312_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
277620..279797
Genome map
AA seq 725 aa AA seqDB search
MILNPELTEKGEIKDLMKSKDSFRAFPLAAITGHSLLKLSLLLAAVDPSLGGVVIAGGRG
TGKSVLARGLHTLLPPIEVLDNELILEKLTKRNSNTSLRPIGRNLDPDKPEEWDISTNKL
LEEAIGSDYLNQIEEIPKKVREAPFIQVPIGITEDRLVGSIDVAASLSTGEQVFQPGILA
EAHRGVLYVDDINLLDDGIVNLILEATGREKNNIERDGLSLSHPCKSLLIATYNPEEGAL
RDHVLDRFAIVLSADQSIDNTQRVEITKSVLSHAENNIKFSEKWSEESDNLSTQLILARQ
WLKDVKITKEQITYLVNEALRGGVEGHRSELFAVKVAKANAALRGDENVNSEDLKVAVRL
VILPRAMQIPPEDEDIQPPPPEDQSPPPPPQSNNDDSEPEANENDNNQDQEQEEDNSDGE
EESTPEIPEEFILDPEACMVDPDLLLFSSAKAKAGNSGSRSVIFSDSRGRYVKPVIPRGK
VKRIAVDATLRAAAPYQKSRRLRNPNKSIVIEENDFRAKLLQKKAGALVIFLVDASGSMA
LNRMQSAKGAVIRLLTEAYENRDEVALIPFRGNQAEVLLPPTRSITAAKRRLETMPCGGG
SPLAHGLTQSAKVAKNALSTGDIGQVIVVAITDGRGNVPLGLSLGKNEVEEKDNENVNLK
QEVLDIAAKYPILGIKLLIIDTERKFIASGFGKELAEAARGKYVQLPKATDKAIAAMALN
AINEF
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgattttgaaccccgagttaacagaaaaaggagagataaaggatttaatgaagtcaaag
gattcttttagagctttccctttagctgcaattacaggtcatagcttattaaaattatct
ttgcttctagcagcagttgatcccagtttagggggagtggttatcgctggcggaagaggt
actggaaagtcagtattagcaaggggtttgcatactttactccctcctatagaggtatta
gataatgaattaatactggaaaagctaactaagagaaatagtaatacttcattaagacct
attggtaggaacctagatccagataaacctgaagaatgggatattagtactaataaattg
ttagaggaggcaattggaagtgattatttgaatcaaattgaagaaattccaaaaaaagta
agagaggcaccatttattcaagttcctattggcataactgaagacagacttgttggatca
attgacgttgctgcttcattaagtacgggggaacaagtttttcagcctggaattttggca
gaagctcatagaggtgttctttatgtagacgatataaatttattggatgatggtattgta
aatttaattcttgaagctacgggaagagagaaaaataatattgaaagagatggtttgagc
ctttctcatccttgtaagtcacttttaatagcaacttataatcctgaagaaggtgcttta
agagatcatgttttagatcgttttgcgattgtgctttccgcagatcaatctattgataat
actcaaagagttgagattacaaaatctgttttatcacacgcagaaaataatattaaattt
tcagaaaagtggtccgaagaatctgataatttatctactcaattaattttagcaaggcag
tggttaaaggatgtcaagataacaaaagagcaaataacctatttagtgaatgaggctctt
agaggaggcgtagaaggtcataggtcagaattgtttgcagtaaaagtagcaaaggcaaat
gcagctcttaggggtgatgagaatgtaaattctgaagacctaaaagtcgcagtaaggtta
gttatccttccgagagcaatgcaaataccacctgaagatgaagatatacaacctcctcct
ccagaggatcagagtcctcctcccccacctcaatcaaataatgatgactcggaacctgag
gctaatgaaaacgataataatcaagatcaagagcaagaagaagataattctgatggagaa
gaagaatctacccctgaaatacccgaagaatttatattagatcctgaggcatgtatggtt
gaccctgatttactgcttttttcatctgccaaagcaaaagcaggaaatagtggaagtaga
tcagtgatatttagtgacagtagaggaagatatgtaaagccagttattccaagaggcaaa
gtaaaaagaattgcagtagatgcaactcttcgagctgctgcaccttatcaaaaatcaaga
agattaagaaaccctaataaatcaatagttattgaagaaaatgattttagagcaaagctt
ttacaaaaaaaagcaggtgcattagttatttttctggttgatgcgagcggctctatggca
ttaaatagaatgcaaagtgccaaaggtgcagtaataagacttttgacagaggcatatgaa
aatagagatgaagtagctctaattccctttagaggtaatcaggccgaagttcttttacct
ccaacaagatctataactgcagcaaaaagaaggcttgaaacaatgccttgcggaggagga
tcacctttggctcatgggctaacacaatcagcgaaagtagcaaaaaatgctctttctaca
ggagatatcggtcaagttattgttgtggctattactgatggaagaggcaatgtaccctta
ggattgtccttaggaaaaaatgaggttgaagaaaaagataatgaaaatgtcaatttaaaa
caagaggttcttgatattgctgcaaaatatccgatacttggaataaaactcttaataatt
gatacagagagaaaatttattgcaagtggctttggtaaagaattagcagaggcagctaga
ggtaaatatgttcaattgccaaaagctacagataaagcaatcgcagctatggctttaaat
gctataaatgaattctga

DBGET integrated database retrieval system