KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0400Help
Entry
PMT9312_0400      CDS       T00297                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00010  Glycolysis / Gluconeogenesis
pmi00020  Citrate cycle (TCA cycle)
pmi00620  Pyruvate metabolism
pmi01100  Metabolic pathways
pmi01110  Biosynthesis of secondary metabolites
pmi01120  Microbial metabolism in diverse environments
pmi01130  Biosynthesis of antibiotics
pmi01200  Carbon metabolism
Module
pmi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT9312_0400
   00020 Citrate cycle (TCA cycle)
    PMT9312_0400
   00620 Pyruvate metabolism
    PMT9312_0400
Enzymes [BR:pmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PMT9312_0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CDC73_N MadL
Motif
Other DBs
NCBI-ProteinID: ABB49461
CYORF: PMT9312_0400
UniProt: Q31CD4
Position
379566..380933
Genome map
AA seq 455 aa AA seqDB search
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENEDEIASVKEQNKGNQPEVSSSDKLELVSNKTEEKPEVHNEN
VKKEEKEVVLKSEKSAPSFNSDQINAATSNVSSRVIASPRAKKLASQMGVDLAKVHGSGP
HGRIQADDILKANGQPVSIPWIGEGSSPASIPGANLQVESKPETSGNSFGNPGETVQFNT
LQKAVNKNMESSLDIPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTIKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRSKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANSDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLASLIENEPETLVS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgaaatattcatgcctgccttgagttctaccatgacagagggcaagattgtg
gaatggttgaaaaatcctggagataaggttgaaaggggtgaatctgtcctagttgttgaa
tctgataaggcagatatggatgttgaatcttttcaagatggatatcttgcagcagtttta
atgcctgctggtagcactgcaccagtaggggaaactataggtcttattgtagaaaatgag
gatgagatagcttctgttaaagaacaaaataaaggaaatcaacccgaagtttctagttcg
gataaacttgaattggtaagcaataaaaccgaagaaaaaccggaagtacataatgaaaat
gttaaaaaagaagaaaaagaagtcgtcttaaagagtgaaaagtcagccccatcttttaat
agtgatcaaattaatgctgctacaagtaatgtttcttcaagggtaattgcatctccaaga
gctaaaaaacttgcctctcaaatgggtgttgacttagcaaaagttcacggatctggacct
cacggaagaattcaagcagatgatattttaaaagctaatggtcaacctgtatctattcca
tggataggagagggtagttctcctgcaagtattcctggtgcaaatttacaagttgaaagt
aaaccagaaacatcaggaaatagttttggtaatcctggagaaacagtgcaatttaatact
cttcaaaaagcggtaaataaaaatatggagtctagtttggatattccatgttttagggtg
ggatactctataaacacagataaattagataatttctacaaaaaggtaaaacaaaatgga
gtcactatgactgctttactagtaaaggcagttgcaaagacaattaagaaacatcctcaa
gttaactcaagtttttcagaaaatggaatttcttatccagaaaatattaatattgctgtt
gccgtcgcaatggaagatggcggattaataactccagttttaaaagaaccttgcaatact
gatttatttgaattatctagggaatggaaagatttggtaaaaagatcaagatcaaaacaa
ttagaacctgatgagtactcaacaggaacctttactttatctaaccttggtatgtttgga
gttgatagatttgacgcaattctacccccaggtactggtgctattttagcgatagcatca
tcgaaaccaactgttgttgctaatagtgatggctcaatatctgttaaaaaaattatgcaa
gtaaatctaaccgctgatcacagagtgatctatggagctgatggtgcttcattcttaaaa
gatttggcttccctgatagaaaatgagccagagacacttgtatcttaa

DBGET integrated database retrieval system