KEGG   Prochlorococcus marinus MIT9312: PMT9312_0408Help
Entry
PMT9312_0408      CDS       T00297                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PMT9312_0408 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PMT9312_0408 (murE)
Enzymes [BR:pmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     PMT9312_0408 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
387107..388642
Genome map
AA seq 511 aa AA seqDB search
MRSIKLHKLLDLVGIIPSLDLIDHEINNISFNSKEVQKGTLFLGMPGLNVDGGKYCIEAI
ENGAEAAIIGSAAKEKIGSIDRERILVIEDNLDYIFGQIVAEFWNRPSRKLKLIGVTGTN
GKTTITFLLEYLLKKLGKKTALFGTLLNRWPGFSEVALHTTDFADKLQKKLNAAVEAESE
FAILEVSSHSIAQNRISGCEFEAAIFTNLTQDHLDYHSDMESYFQTKRKLFFPPYLNEKD
GICVLNHDDHWISKLSSDLEKRSLLVSTKITESEFESDDFFFVTDKKFTEIGSTCIFHTP
REKIQLFVPLVGEFNLMNAIQAITILYKLNFSLKDLSKLIQSFPGAPGRMEKIQIDNNDV
SRSLPTVIVDYAHTPDGLKKVLQSIKKLCEGKLITVFGCGGDRDRSKRPLMGSIAEEFSD
QLFITSDNPRSEEPQKIVNDILMGIKKREKITIEIDRFKAINESIKFAKKKDIVLIAGKG
HEDYQILNDKVINFDDRKIAYKLLKEKNKSQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagatctataaaattacataaacttttagatttggtaggaattattccttcattagat
ttaatcgatcatgaaataaataatatttcttttaactctaaagaagtacaaaaaggaact
ttatttttaggtatgcctggtttaaatgttgatggaggaaaatattgtattgaggcaatt
gaaaatggtgcagaggctgccattattgggtctgctgcaaaagagaaaattggatctatt
gatcgagaaaggattttggttatagaggataatttagattatatttttggtcaaatagtc
gctgagttttggaataggccttcaagaaaacttaaacttattggtgttacgggtacaaat
ggaaaaacgacaattacttttttattggaatatcttttaaaaaaattagggaaaaagact
gcattatttgggaccttgctcaatagatggcctggcttttcagaagtggctcttcataca
actgatttcgccgataaactccaaaagaaattaaatgctgctgttgaggcagaatctgaa
ttcgcgatattagaggtaagttctcattctattgctcaaaacaggatatcaggatgcgaa
tttgaggcggctatttttactaatttaactcaagatcatcttgattatcactcagatatg
gaatcatattttcaaacaaaaagaaaattatttttcccaccttacttaaatgaaaaagat
ggcatttgtgtattaaatcatgatgaccattggatatctaaattatcatctgatcttgaa
aaaagatctttattagtctctacaaagattactgaaagtgaatttgaaagtgatgatttt
tttttcgtaacagataagaaatttactgaaattggttccacctgtatttttcatacacct
agggaaaaaattcaactttttgttccacttgtcggtgaatttaatttaatgaatgcgatt
caagcaataacaattttgtataaacttaatttttctttaaaagatctatcaaaattaata
caatctttccctggtgctcctgggagaatggagaaaatacaaattgataataatgacgtt
tcaagatctcttccaacagtaattgttgattatgcccacactcctgatggattaaaaaaa
gttttgcaatcaattaaaaaactttgtgaagggaaactcataactgtttttggctgtggc
ggagatcgtgatcgtagtaaaaggcctttaatgggatcaatagctgaagagttttctgat
caactttttataacttcagataatccaagatcagaagaaccccaaaagatagtaaatgat
attttgatgggcataaaaaaaagagaaaaaataacaattgaaattgatagatttaaagca
ataaatgaatctattaaatttgctaaaaaaaaagatattgttttaattgcaggaaaagga
catgaagactaccaaattctcaatgataaagttattaattttgatgatagaaaaatagct
tataaattattaaaagaaaaaaataaatctcaataa

DBGET integrated database retrieval system