KEGG   Prochlorococcus marinus MIT9312: PMT9312_0467Help
Entry
PMT9312_0467      CDS       T00297                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PMT9312_0467 (gmk)
Enzymes [BR:pmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PMT9312_0467 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
440400..440954
Genome map
AA seq 184 aa AA seqDB search
MKNQKKLIILTGPSGVGKGTVIKEILGKDKNIWLSISATTREPREGEQEGENYYFLKQEK
FKEMIEKNLFLEWAQFAGNYYGTPLSSVNEKITKGFTVLLEIEVEGAKQIKEKFPESLSI
FLLPPDKAELERRIRNRGTEKEEAIKKRLLRASYEISASNQFDFELTNHNVDETAKRIIK
LIQT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaaaaactcattatccttaccggacctagcggggtaggcaaaggaact
gttattaaagaaatattaggtaaagataaaaatatttggctttcaatatctgcaactaca
agggaacccagagagggagagcaggagggagaaaattattactttttgaagcaagaaaag
ttcaaagaaatgattgaaaaaaacctttttcttgaatgggctcaatttgctgggaactat
tatggaactcctttatcttctgtcaatgagaaaatcacaaagggatttaccgttttactt
gaaattgaggtggaaggtgcaaagcaaataaaggaaaagtttcctgagtccctttcaata
tttttactccctccggataaagcagagttagagagaagaataagaaataggggtacagaa
aaagaagaggcaattaaaaaaagactcttaagggctagttatgagatttctgcatcaaat
caatttgattttgaattaacaaatcacaatgttgatgaaacagctaagagaataatcaag
ttaatacaaacttga

DBGET integrated database retrieval system