KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0467Help
Entry
PMT9312_0467      CDS       T00297                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00230  Purine metabolism
pmi01100  Metabolic pathways
Module
pmi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PMT9312_0467
Enzymes [BR:pmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PMT9312_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 RsgA_GTPase Rad17 ABC_tran MMR_HSR1 AAA_16 AAA_22 NTPase_1 AAA_17 NB-ARC AAA_14 AAA AAA_29 T2SSE AAA_30
Motif
Other DBs
NCBI-ProteinID: ABB49528
CYORF: PMT9312_0467
UniProt: Q31C67
Position
440400..440954
Genome map
AA seq 184 aa AA seqDB search
MKNQKKLIILTGPSGVGKGTVIKEILGKDKNIWLSISATTREPREGEQEGENYYFLKQEK
FKEMIEKNLFLEWAQFAGNYYGTPLSSVNEKITKGFTVLLEIEVEGAKQIKEKFPESLSI
FLLPPDKAELERRIRNRGTEKEEAIKKRLLRASYEISASNQFDFELTNHNVDETAKRIIK
LIQT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaaaaactcattatccttaccggacctagcggggtaggcaaaggaact
gttattaaagaaatattaggtaaagataaaaatatttggctttcaatatctgcaactaca
agggaacccagagagggagagcaggagggagaaaattattactttttgaagcaagaaaag
ttcaaagaaatgattgaaaaaaacctttttcttgaatgggctcaatttgctgggaactat
tatggaactcctttatcttctgtcaatgagaaaatcacaaagggatttaccgttttactt
gaaattgaggtggaaggtgcaaagcaaataaaggaaaagtttcctgagtccctttcaata
tttttactccctccggataaagcagagttagagagaagaataagaaataggggtacagaa
aaagaagaggcaattaaaaaaagactcttaagggctagttatgagatttctgcatcaaat
caatttgattttgaattaacaaatcacaatgttgatgaaacagctaagagaataatcaag
ttaatacaaacttga

DBGET integrated database retrieval system