KEGG   Prochlorococcus marinus MIT9312: PMT9312_0536Help
Entry
PMT9312_0536      CDS       T00297                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PMT9312_0536
Enzymes [BR:pmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PMT9312_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
501991..502731
Genome map
AA seq 246 aa AA seqDB search
MTSTLPNDNIRNFDDQITNKLISEIIRDRIKNSGTRFSANDNIADFINPGELEILEKEVA
SRVKDLLKSLVIDVENDHNTQETAERVSKMYLNEVFKGRYHEQPKVTSFPNDKNLDEIYT
VGPISVRSACSHHLVPILGECWIGIKPGNKVIGLSKFARVADWVFSRPHIQEEAVMILAD
EIEKLCEPKGLGIIVKAQHYCMKWRGVKEPNTSMINSVVRGDFRHDLSLKQEFFELVKQQ
SATNNY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctctacattacccaacgataatattagaaactttgatgaccagattactaataaa
ctaatctctgaaattatcagagacagaattaagaattctgggacaagattcagtgcaaat
gataacattgcagactttataaatcctggagaattagaaattctagaaaaagaagtagcc
tccagagttaaagacctccttaagtccttagtaatagatgttgaaaatgatcataatact
caagagactgcagaaagagtctcaaagatgtatttaaatgaagtttttaaagggagatat
catgaacaacccaaagttacaagttttccaaacgataagaatcttgatgagatttatact
gtaggccctatttcagtaagatctgcatgttcacatcatttggtcccaattcttggggag
tgttggataggcattaaacctgggaataaagttatagggctctcaaaatttgcaagagtc
gctgattgggttttttcaagacctcatattcaagaagaagctgtaatgatactcgcagat
gaaattgaaaaattgtgtgaacctaaaggtttaggtattattgtgaaggcccaacactat
tgtatgaaatggaggggagttaaagaaccaaatacaagtatgattaattctgtagtaaga
ggcgactttaggcatgacttaagtttaaaacaagaattttttgaacttgtaaaacagcaa
tctgcaactaataactactaa

DBGET integrated database retrieval system