KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0572Help
Entry
PMT9312_0572      CDS       T00297                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMT9312_0572
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMT9312_0572
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMT9312_0572
Enzymes [BR:pmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMT9312_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
533472..534314
Genome map
AA seq 280 aa AA seqDB search
MKDNKMQITKNESLSKVDEKFYELKKNKKIALMPFIMAGDPNIEITSEILLKLQENGADL
IELGIPYSDPLADGPVIQVAASRALKSGTTPRKVITILESLKGKLNIPIILFSYLNPLLC
FGFEQFCETASNAGVSGLIIPDLPLEEACKFSKIVSNHSMDLILLVAPTTPFERMKQISN
HTKGFTYLVSVTGVTGERNKMENRVENLIAKLKEINSNPIAVGFGISTPEHVNKVREWGA
DGVIIGSAFVKRISSSSERDVVDHVGEFCKDMRLAADQKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataacaaaatgcaaattactaaaaatgaatctttatcaaaggtagatgagaag
ttttatgagttaaaaaaaaataaaaaaatagctttgatgcctttcataatggctggggat
cccaatattgaaataacctctgagatcttattaaagttacaagaaaatggagcggacctt
attgaattaggcatcccatacagtgatccactcgcagacggacctgttattcaagtagcg
gcctctcgcgccttaaagtcaggtactaccccaagaaaagtaattacaattttagagtct
ttaaaaggtaaattaaatattcccatcatacttttttcttacttaaatcccttactatgt
tttggctttgaacagttttgtgagacagcatctaatgctggtgtttctggactaataatt
cctgatctacctttagaggaagcttgtaaattttctaaaatagttagcaaccattctatg
gacttgattttattggtagctccaactactccttttgaaagaatgaaacaaatatcaaat
catacaaaaggctttacttatttggtaagtgttacaggtgtcactggtgagagaaataaa
atggaaaatagagtagaaaatcttatcgctaaattaaaagaaataaattctaatccaatt
gctgttggttttgggatatcaactcctgaacatgttaataaagttcgagagtggggagca
gatggagtaattattgggagcgcatttgtaaaacgaatttctagttcaagtgaaagagat
gtcgttgatcatgtgggtgaattttgtaaggatatgcgtttagctgctgatcaaaaaaaa
taa

DBGET integrated database retrieval system