KEGG   Prochlorococcus marinus MIT9312: PMT9312_0584Help
Entry
PMT9312_0584      CDS       T00297                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMT9312_0584
Enzymes [BR:pmi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PMT9312_0584
Exosome [BR:pmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMT9312_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(543609..545873)
Genome map
AA seq 754 aa AA seqDB search
MIETIQADWIQSEAINLENCCNDNPLKILGPHFYEEQWVIRVWMPEADEVKINFKNNTYK
AESINHKWLFEAILPENPESNYEINISRGGITHTQHDPWSYIEEWMGEVDRHLFAEGNHH
HIWEKMGAHLIEEKNQKGVMFCIWAPNAKSISIIGDINSWDGRHHPMQKRLGGIWELFMP
TMEEGDTYKYEIRTQQGHIYEKADPYGFLHEIRPQNGSIVSKLKNFNWNDNAWITNRDSS
SQINKPISVYEMHLGSWLHESTDNKYIEDNGNPRNPVPAADLKPGTRLLTYPELTEKLIP
YVKDRGFTHIELMPISEHPFDGSWGYQVTGWYAPTSRFGTPNEFREFVNKCHEEGIGVIL
DWVPGHFPKDKHGLAFFDGCHLYEHGDSRIGEHKEWGTLIFNYSRNEVRNFLVANLVYWF
EEFHIDGIRVDAVASMLYRDYLRPDGEWIPNENGGNENIEAVKFLQQANHVLFQHFPGAL
SIAEESTTWPMVTKPTDMGGLGFNLKWNMGWMHDMLDYFEIDPWFRQFHQNSVTFSITYN
YTENFMLALSHDEVVHGKSHLLHKMPGDDWKKYANTRALLTYMWTHPGKKTIFMGMEFGQ
RQEWNVWDDLQWDLLEFEPHKGIRNLVDDLNALYKNEPALWKNDFDPYGFQWIDCNDKSN
SVISFMRRENDTNEWLVIVANFTPNTHDSYKVGVPVEGFYKEIFNSDGSRYGGSNKGNMG
GKEAINYNIHDYQNALELALPPLSVSIFKHQSKK
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagacaattcaagcagactggattcaatcagaagctatcaacctagaaaattgt
tgcaatgataatccattaaaaatattaggtcctcatttttatgaagagcaatgggtaata
agggtatggatgcctgaagccgacgaagttaaaataaattttaaaaataatacctataag
gcggaaagcataaaccataaatggctttttgaagcaatcctgcctgaaaatccagagtct
aattacgaaataaatatttcacgaggagggatcacacatacacaacatgacccctggtca
tatatagaagagtggatgggagaagttgatagacatctttttgcagaaggtaatcatcat
catatttgggaaaaaatgggagcacatctcattgaagaaaaaaatcaaaaaggtgtcatg
ttctgcatttgggctccaaatgcaaaatcaatctcgataattggagatataaattcttgg
gatggaagacatcatccaatgcaaaaaagattaggaggaatttgggaactattcatgcca
acaatggaagagggagatacatataaatatgaaataagaacacaacaaggtcatatttat
gagaaagctgatccatatggtttccttcatgaaatcagacctcaaaatggttcaatagtt
tcaaaattgaaaaactttaattggaatgataatgcttggattacaaatagagattcctct
agtcaaatcaataagccaatctcagtttatgagatgcatttaggaagttggctccatgaa
tcaacagataataaatatattgaagacaatgggaatcctagaaacccagtacctgctgca
gatttaaaacctggaacaagacttttaacttatccagaattaaccgaaaaactcatccct
tatgtaaaagatagaggatttactcatattgaactaatgccaatatctgaacatcctttc
gatggttcatggggataccaggttacaggttggtatgcacctacaagtaggtttggcact
ccaaatgaatttagagagtttgtaaataaatgtcatgaagagggaataggagtaattctt
gattgggtacctggtcattttccaaaagacaagcatggcttagcattttttgatggttgt
catctttatgaacatggggattcacgcataggtgaacacaaagaatggggaactttaatt
tttaattacagcagaaacgaagtaaggaatttcctagtagccaatctggtttattggttt
gaagaatttcatattgatggcatacgagtagatgcagtagcttcaatgctatacagagac
tatctacgcccagatggagaatggatacctaatgagaatggtgggaatgaaaatatagaa
gccgttaaatttcttcaacaggctaatcatgtactcttccaacatttccctggtgcactt
tctattgctgaagaatcaacaacttggccaatggtaaccaaaccaacagatatgggagga
ttagggtttaatttaaaatggaatatgggttggatgcacgatatgctcgattattttgag
atagatccttggttcagacaattccatcaaaatagtgtaactttctccataacatataac
tatacagagaactttatgcttgctctcagtcatgatgaagtagtccatggaaaaagtcat
cttttacataaaatgcctggcgacgactggaagaaatatgcaaatactcgtgcattacta
acttatatgtggacccatccaggtaaaaaaacaatatttatgggaatggaatttggacaa
agacaagaatggaatgtttgggatgatcttcaatgggatttactagaatttgaacctcat
aaagggatcagaaacttggttgatgatctaaatgcactttataaaaatgaacctgcgtta
tggaaaaatgactttgatccttatggattccaatggattgactgtaatgacaaatctaat
tcagtaataagtttcatgagaagagagaacgacactaatgaatggcttgttattgttgct
aactttacacctaatactcatgattcatataaagtaggtgttcctgtagaaggattctat
aaagagatatttaattctgatggctctagatacggaggcagtaataaaggaaatatggga
ggtaaagaagctataaattacaatattcatgattatcaaaatgctctagaacttgctttg
ccgccattaagcgtgagtatcttcaaacatcaatcaaaaaaataa

DBGET integrated database retrieval system