KEGG   Prochlorococcus marinus MIT9312: PMT9312_0596Help
Entry
PMT9312_0596      CDS       T00297                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMT9312_0596
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT9312_0596
   00052 Galactose metabolism
    PMT9312_0596
   00500 Starch and sucrose metabolism
    PMT9312_0596
   00520 Amino sugar and nucleotide sugar metabolism
    PMT9312_0596
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PMT9312_0596
   00524 Butirosin and neomycin biosynthesis
    PMT9312_0596
Enzymes [BR:pmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PMT9312_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(559922..560959)
Genome map
AA seq 345 aa AA seqDB search
MNFLACDLGGTKVLLGIFKKDINDDSPKLIFKKKYISSDWNSFELILEDFLKNECKNIAH
PYSACFAVAGPLSNNNAKIINLSWNISGNALQKKFNFKSCELINDFAVQIYGIPYLKENQ
YSTIQNGDFFAGTNNDLHAIVGAGTGLGIARGIISENNVKVLASEGGHVEYSPKSKLEWE
LKIWLKNYLKVERISCERIVSGIGLSRIAEWRLSKPDAKNHPLQKYFKEIKISDALRKEI
PEKICTFSNKGDQLMIEVERIWLGAYASLLGDVALQELCFGGLWISGGTAPKHFKNFKSN
IFMKQFFDKGRLKDILKTIPLKVILDEEFGLFSAACRAKMLLKTE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctggcttgtgatttaggaggtaccaaggttcttttgggaatatttaaaaaa
gatataaatgatgattcacctaagttaatattcaaaaagaaatatatatcttctgattgg
aactcttttgaattaatcctagaagattttctcaaaaatgaatgcaaaaatattgctcat
ccttattctgcatgcttcgcagtagctggtcctttatctaataacaacgcaaaaattatt
aacttgtcgtggaatatatctggaaatgcattacagaagaaatttaattttaaaagctgc
gagctaataaatgatttcgcagtgcaaatttacggaataccttatttaaaagaaaatcaa
tattcaacaatccagaatggggacttttttgcaggtactaataatgatttgcatgccata
gttggagctgggacaggtttaggcattgcaagaggaataatatcagaaaataatgtgaaa
gttttagctagcgaaggtggtcatgttgaatactcgccaaagtcaaaattagaatgggaa
ttaaagatttggcttaagaattatctaaaagttgagaggatatcttgtgaaagaattgtt
agtggtattggtttatcgagaattgccgaatggagactgagcaaacctgatgctaaaaac
catcctttacaaaaatattttaaagaaattaaaatttctgacgctttgagaaaagaaatc
ccagaaaaaatttgtacgttttcgaataagggggatcagttaatgattgaagtagagagg
atatggttaggtgcttatgcctctttattaggagatgtcgctcttcaagaattatgcttt
ggagggttatggatttcaggaggaacggcaccaaaacatttcaaaaactttaaatcaaat
atatttatgaaacaattttttgataaaggaagattaaaagatattcttaaaacaatacct
ctgaaagtgattttagatgaagagtttgggctttttagtgcagcctgcagagcaaaaatg
cttttaaaaactgagtaa

DBGET integrated database retrieval system