KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0619Help
Entry
PMT9312_0619      CDS       T00297                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00010  Glycolysis / Gluconeogenesis
pmi00620  Pyruvate metabolism
pmi00640  Propanoate metabolism
pmi00680  Methane metabolism
pmi01100  Metabolic pathways
pmi01110  Biosynthesis of secondary metabolites
pmi01120  Microbial metabolism in diverse environments
pmi01130  Biosynthesis of antibiotics
pmi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT9312_0619
   00620 Pyruvate metabolism
    PMT9312_0619
   00640 Propanoate metabolism
    PMT9312_0619
  Energy metabolism
   00680 Methane metabolism
    PMT9312_0619
Enzymes [BR:pmi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PMT9312_0619
Lipid biosynthesis proteins [BR:pmi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PMT9312_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABB49680
CYORF: PMT9312_0619
UniProt: Q31BR5
Position
584413..586395
Genome map
AA seq 660 aa AA seqDB search
MSLDKKNSINNILEEKRIFPPSKQFAENSNISSQKELLSLKEQASENPTQFWESFAKSEL
DWFEPFQTVLDSKNAPFFKWFKEGKLNITYNCLDRHISRGLGGKTALIWEGEPGDSKKYT
YEELLKEVCKASNALKTIGVKKGDLVCIYMPMIPEAMFAMLACARIGAPHSVVFGGFSSE
ALKDRLIDGNARFVITADGGFRKDKVIELKQAVDAAIESGADKVVEKVVVVQRTKKSISM
VDGRDFWWHELLKDQKDECEPEIMNSEDRLFILYTSGSTGKPKGVVHTTGGYNLWSHLTF
KWIFDLKDDDIYWCTADVGWITGHSYIVYGPLSNGATTLMFEGVPRPSNLGAFWEIVQKY
KVSIFYTAPTAIRAFMKSGREIPDKYNLDSLRLLGTVGEPINPEAWIWYKDVIGKNKCPI
VDTWWQTETGGVMISPLPGVVPTKPGSATYPLPGIEVEIVDKNGDKVMENEGGYLIIKKP
WPGMMRTIHGNSKRYLESYWEYISFKGEKNVYFAGDGARIDEDGYIWIMGRVDDVISVSG
HRLGTMEIESALVSHKSVAEAAVVGRRDDLKGEVIVAFVSLEKDVNSSSELVEELKKHVV
NEIGIIAKPEKIVISDSLPKTRSGKIMRRILRSLAAGEKISGDISTLEDSSVLEKLKEKS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtcattagataaaaaaaattccatcaacaacatacttgaagaaaagagaattttccct
ccatcaaaacaatttgcagaaaactcaaatattagttctcaaaaagaattactaagtcta
aaagaacaagcatcagaaaatcctactcaattctgggaatcttttgcaaaatctgaatta
gattggtttgagccatttcaaactgtattagatagcaaaaatgcccccttttttaagtgg
tttaaagaaggaaaactcaacattacatataactgcttagatagacatattagtagagga
cttggagggaaaactgcattaatatgggaaggtgaacctggagatagcaaaaaatatact
tatgaagaacttttaaaagaggtatgtaaagcttccaatgcattaaaaaccattggagta
aaaaaaggagatttggtatgtatttatatgccaatgattcctgaagcaatgtttgcgatg
ttagcttgcgcaagaattggggctcctcattcagttgtctttggagggttttcttcagaa
gctttaaaagatagattaattgatggaaatgccagatttgttattacggcagatggtggc
tttagaaaagataaggtgattgagcttaagcaagcagttgatgcggcaattgaaagtggg
gcagataaagttgttgaaaaagttgttgttgttcaaagaactaaaaaaagcatttctatg
gttgatggcagagatttttggtggcacgaattattaaaagatcaaaaagatgagtgtgaa
ccagaaataatgaatagcgaagatagactttttattctttatacttcaggctctactgga
aaacctaaaggtgtagttcacactacaggtggttataatctttggtcccatttgacattt
aaatggatttttgatttaaaagatgacgatatttattggtgtactgctgatgttggttgg
attacaggccatagttatatagtttatggccccttatctaatggcgctacaaccttaatg
tttgagggagtaccaaggccatctaatttaggggctttttgggaaattgttcagaaatat
aaggtttccattttttatactgctccaactgcaataagagcatttatgaagtctggacgt
gaaattcctgataaatataatctggacagtcttagacttttgggcacagttggagaacca
attaatcctgaagcatggatatggtacaaagatgttattggtaaaaataaatgtcccata
gttgatacatggtggcaaactgaaactggaggtgtaatgataagccctttgcctggagtt
gttcccacaaagccgggttcagctacttatcccttgcctggaattgaagttgaaatcgtt
gataagaatggagataaagttatggagaacgagggcggttatttaattattaagaagcct
tggccagggatgatgagaacaattcatgggaactcaaagagatacttggagagttattgg
gaatatatttcttttaaaggagaaaagaatgtttatttcgctggagatggagcacgtatt
gatgaagatggatatatttggattatggggagagttgatgatgttataagtgtttcaggt
catcggttaggaacgatggaaatagaatcggctttggtaagtcataaatcagtggctgaa
gccgctgttgtgggaaggagagatgatctaaaaggggaagtaatagtcgctttcgtctct
ctagagaaagatgttaatagttcttcagaattagtagaagaattaaagaaacatgttgtt
aatgaaattggaattatcgctaagccagaaaaaatagtaatttctgactctcttcctaaa
acacgaagtggaaaaattatgaggagaattttgagatctttggcagctggagaaaaaatt
agtggtgatataagtactcttgaagatagttctgttttagaaaagttgaaagaaaaatct
taa

DBGET integrated database retrieval system