KEGG   Prochlorococcus marinus MIT9312: PMT9312_0838Help
Entry
PMT9312_0838      CDS       T00297                                 

Definition
alpha amylase domain-containing protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMT9312_0838
Enzymes [BR:pmi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PMT9312_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
774863..776623
Genome map
AA seq 586 aa AA seqDB search
MKQIDSEKKLDRSKLYKLLKTIYSSNTTEEINFISNQLLQILDDFSEKSAYEEISDNEKW
NESHSVLITYADSIYKNGEKTLITLRDLLTKHFGSLSKVVHILPFLKSTSDGGFAVSSYD
SLEEKFGGWDDLKSISKNHVLMADLVLNHVSSSHPWVQQFIKSQEPGISNVFSPEQNLDW
SNVVRPRSSSLFSQINTEDGPKQVWTTFGPDQIDLNWHNPKMTLEFLNLIITYLSNGIKW
LRLDAVGFIWKESGTTCLHLPKAHSIVTLLRVLLNNLLDDGVLITETNVPQKENLSYLIP
DNEAHMAYNFPLPPLLLEAIITSRADILNLWISDWPILPDDTTLFNFTASHDGVGLRALE
GLMNEQRIKGLLINCEKRGGLVSHRRLSNGEDKPYELNISWWSAMEDSSRDSNRFQFERF
ILTQLLVMALKGVPAFYLPALLASENDIKSFSMTGQRRDLNREKFRLDNLLSVLNNPESK
ANKNLNYLRNAMDIRSQSKQFHPCSGMKCLSKGRSDIVVIKRGNGPESVFAIHNMTDNKI
NYQLNDNDLPEIIDNDFNMRDFLTATKYNWKNISLDPFQVIWLGGF
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaaattgattcagagaaaaaattagatagatcaaaactttataaattgttgaaa
acaatttattcaagtaatactacagaagaaattaactttatttcaaatcaattattacag
attttagatgatttctcagagaaatctgcttatgaagaaataagtgataacgaaaagtgg
aatgaatctcattcagttttaataacttatgcagatagtatttataaaaatggggagaaa
actttaattactcttcgagatttgttaactaaacattttggcagtctttctaaagttgta
catattcttccttttttgaaatccacaagcgatggaggctttgcagtctcaagttatgat
tccctagaagaaaaatttggtggttgggatgatctcaaaagtatttccaaaaatcatgtt
ttgatggctgatttggtactaaatcatgtttcatcatctcacccatgggttcaacaattt
attaaatcccaagaaccaggaatatcaaatgttttttcaccggaacaaaatcttgactgg
tcaaatgtagttagaccaagaagttcttccttgttttctcaaataaatactgaagatggt
cctaaacaagtttggacaacttttggtccggatcaaattgatttgaattggcataatcca
aaaatgactcttgagttcttaaatttaattattacttatttatctaatgggattaaatgg
ttgaggcttgatgctgtaggttttatttggaaggaatcagggacaacatgcttacatttg
ccaaaagcacattcaatagtaactcttttaagagttctattaaataatcttcttgacgat
ggagttttaataacagaaacaaatgttcctcagaaggaaaatctctcttatcttattcca
gataatgaagcccatatggcatataattttccattgcctcctcttctcctagaggcaatt
attacttcaagagccgatattctaaacttgtggatttcagattggccaatattgccagac
gatactactctttttaatttcactgcatcacatgatggcgttgggttaagagctcttgag
ggtctaatgaatgagcagagaattaaaggtttattaattaattgtgagaaaagaggagga
ttagtaagtcatagacgtttatcaaatggtgaggataaaccttatgaattgaatattagt
tggtggagcgcaatggaagactccagcagagattcaaatcgattccagtttgagagattt
atcttgactcaattattagtaatggctttgaaaggagtccctgccttttatttgccagca
ttacttgcttcagaaaatgatatcaaaagtttttctatgacaggtcaaagaagagatctc
aatagagaaaaatttagattagataatcttttatctgttttaaataatcctgaatctaag
gctaataaaaacttaaattatcttcgtaatgctatggatatcaggtcacaatcaaagcaa
tttcatccttgctcgggaatgaaatgtttatctaaaggtagaagcgatattgtcgtaatc
aaaagaggtaatggtccagaatctgtttttgcaatccataatatgactgataataaaatt
aattatcaattgaacgataatgatctaccagaaataattgataatgattttaatatgcga
gattttttaacagccactaaatacaattggaaaaatattagtcttgatccttttcaagtt
atttggcttggtggtttttaa

DBGET integrated database retrieval system