KEGG   Prochlorococcus marinus MIT9312: PMT9312_0857Help
Entry
PMT9312_0857      CDS       T00297                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMT9312_0857
Enzymes [BR:pmi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PMT9312_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(793472..794149)
Genome map
AA seq 225 aa AA seqDB search
MISWISGELVELWQTNQKFFLLINCQGLGYEIQVLESLFLKLKTNQITNKNITLWIKHIK
KEDSDLLFGFSSKDQKNFFIEILNIRGVGSQIGMGILSKFSISEVINAINTQNKKLICSV
PGIGQKMSERLILELKSKFRNELKIQEEKSKDEFHIKDNKINKIVSDIELTLKSLNYTKN
EIKSILPIISKEIDSLTKKEKDTSFENLLMLAMNYLDNDSSNIVR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttgattagttggattagtggagaattggttgaattatggcaaactaatcaaaaatttttt
cttttaataaattgtcaaggattagggtacgaaattcaagtcttagaatctttatttctc
aaattaaaaacgaatcagataactaataaaaacatcactctttggataaaacatattaaa
aaagaagattcagatttattatttggatttagctcgaaggatcaaaaaaatttttttatt
gaaattttaaatattagaggtgttggttcccaaattggtatgggtatattaagtaaattt
tccattagtgaagtaatcaatgcaattaatacacaaaacaaaaaattaatttgttccgta
cctggtataggacaaaaaatgagtgagaggttaattttagaattaaaaagtaaatttaga
aacgaattaaaaattcaggaagaaaaaagcaaagatgaatttcatattaaggataataaa
attaataaaattgtgagtgacattgaattaaccttaaagtccttaaactacactaagaat
gaaataaaaagtattttgccaatcattagcaaagaaatagatagccttactaaaaaggaa
aaagatacatcatttgaaaatttattaatgttagctatgaattatttagataatgatagt
agtaatatagtcagataa

DBGET integrated database retrieval system