KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0970Help
Entry
PMT9312_0970      CDS       T00297                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00790  Folate biosynthesis
pmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PMT9312_0970
Enzymes [BR:pmi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PMT9312_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABB50030
CYORF: PMT9312_0970
UniProt: Q31AR5
Position
complement(904622..905476)
Genome map
AA seq 284 aa AA seqDB search
MPELQIINKQNPWPKGWRQKTSIMGVINLTPDSFSDGGDLNSINKVLDQVNHFVCNGVDV
IDLGAQSTRPGAEEVGSSIEIKRLIPYLKLIKSEYPDVLISIDTFNSEVAYETLLNGANW
INDVTGGRRDRKILDVVSKFKCPFVITHSRGNSQNMNKLSKYSNLLSEVKTSLDSLITIA
LERNISKSNIIVDPGIGFSKDINQNLKILKNLDVFKNLNLPILIGASRKRFLGEILDEKN
PKERDIGTLAISCVCSHFNIDIVRVHNVKMNYQILKVADRIYRK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgccagaattgcaaattatcaataagcaaaatccatggccaaaaggctggagacaaaaa
acttcaattatgggagttattaatttaactcctgattcatttagtgatggtggagattta
aattctataaataaagttttagatcaagtcaatcattttgtgtgtaatggtgtggatgtt
attgatcttggtgcccagagtacgagacctggggctgaagaagttggatctagtatagaa
ataaaaagattgatcccatatcttaaattaataaaatctgaatatccagatgttttgatt
tctattgatacatttaattctgaggtagcttacgaaactcttttaaatggtgctaattgg
ataaatgatgtcactggaggaagaagagatagaaaaattctggatgtagtttcaaaattc
aaatgcccatttgttattacccatagtcgaggaaatagtcaaaatatgaataaactttcc
aaatacagtaatttattgagtgaagttaaaacttctcttgatagtttaataacaattgct
ttagaaagaaatatatctaaaagcaatataattgtggatcccggaattggtttttcaaag
gatattaatcaaaatttgaaaattctaaaaaacttagatgtatttaaaaacttaaattta
ccaatattaattggtgcatcaagaaaaagatttttaggagaaattttggatgagaaaaat
cccaaagaaagggatattggaacccttgcaataagttgtgtttgttcccactttaatatt
gatattgtgagagttcacaatgtaaaaatgaattatcaaattctaaaagttgctgatagg
atttatagaaaataa

DBGET integrated database retrieval system