KEGG   Prochlorococcus marinus MIT9312: PMT9312_0970Help
Entry
PMT9312_0970      CDS       T00297                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PMT9312_0970
Enzymes [BR:pmi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PMT9312_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(904622..905476)
Genome map
AA seq 284 aa AA seqDB search
MPELQIINKQNPWPKGWRQKTSIMGVINLTPDSFSDGGDLNSINKVLDQVNHFVCNGVDV
IDLGAQSTRPGAEEVGSSIEIKRLIPYLKLIKSEYPDVLISIDTFNSEVAYETLLNGANW
INDVTGGRRDRKILDVVSKFKCPFVITHSRGNSQNMNKLSKYSNLLSEVKTSLDSLITIA
LERNISKSNIIVDPGIGFSKDINQNLKILKNLDVFKNLNLPILIGASRKRFLGEILDEKN
PKERDIGTLAISCVCSHFNIDIVRVHNVKMNYQILKVADRIYRK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgccagaattgcaaattatcaataagcaaaatccatggccaaaaggctggagacaaaaa
acttcaattatgggagttattaatttaactcctgattcatttagtgatggtggagattta
aattctataaataaagttttagatcaagtcaatcattttgtgtgtaatggtgtggatgtt
attgatcttggtgcccagagtacgagacctggggctgaagaagttggatctagtatagaa
ataaaaagattgatcccatatcttaaattaataaaatctgaatatccagatgttttgatt
tctattgatacatttaattctgaggtagcttacgaaactcttttaaatggtgctaattgg
ataaatgatgtcactggaggaagaagagatagaaaaattctggatgtagtttcaaaattc
aaatgcccatttgttattacccatagtcgaggaaatagtcaaaatatgaataaactttcc
aaatacagtaatttattgagtgaagttaaaacttctcttgatagtttaataacaattgct
ttagaaagaaatatatctaaaagcaatataattgtggatcccggaattggtttttcaaag
gatattaatcaaaatttgaaaattctaaaaaacttagatgtatttaaaaacttaaattta
ccaatattaattggtgcatcaagaaaaagatttttaggagaaattttggatgagaaaaat
cccaaagaaagggatattggaacccttgcaataagttgtgtttgttcccactttaatatt
gatattgtgagagttcacaatgtaaaaatgaattatcaaattctaaaagttgctgatagg
atttatagaaaataa

DBGET integrated database retrieval system