KEGG   Prochlorococcus marinus MIT9312: PMT9312_0971Help
Entry
PMT9312_0971      CDS       T00297                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMT9312_0971 (tpiA)
   01230 Biosynthesis of amino acids
    PMT9312_0971 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT9312_0971 (tpiA)
   00051 Fructose and mannose metabolism
    PMT9312_0971 (tpiA)
   00562 Inositol phosphate metabolism
    PMT9312_0971 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMT9312_0971 (tpiA)
Enzymes [BR:pmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PMT9312_0971 (tpiA)
Exosome [BR:pmi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PMT9312_0971 (tpiA)
  Exosomal proteins of bladder cancer cells
   PMT9312_0971 (tpiA)
  Exosomal proteins of melanoma cells
   PMT9312_0971 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(905451..906176)
Genome map
AA seq 241 aa AA seqDB search
MRKSVIAGNWKMHMTCAEAKSYLEEFIPLIKNIRDDRKVVIAPPFTAISTFSKHSDFDYL
DISSQNIHWEDEGAFTAEISPKMLIEHGVSYAIVGHSEPRKYFSESDEQINKRAVFAQCS
GLTPIVCVGETLEQRERGEADRVITRQVEQGLENTDPSNLIVAYEPIWAIGTGKTCEAKD
ANNICSLIRKLIGFDDVIIQYGGSVKPNNIDEIMSMSDIDGVLVGGASLDPNSFARIANY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaatctgttattgctggtaattggaaaatgcatatgacttgtgctgaagcgaag
tcttatttagaagagtttatacctttaataaaaaacatcagagatgatcgtaaagttgtt
attgcgccaccttttacagctatttcaaccttttctaagcattctgattttgattattta
gatatttctagtcaaaatattcattgggaagatgaaggagcatttactgcggaaatatct
ccaaaaatgctgattgaacatggagtctcatatgcaatagttggtcacagtgaaccaaga
aaatattttagtgaaagtgatgaacaaattaataaaagagcagtttttgctcaatgtagt
ggacttactcccatagtttgtgttggagaaacactagaacaaagagagagaggagaggct
gatagagttatcactagacaggtagaacaagggctagaaaatacagatccatcaaattta
attgttgcctatgaaccaatttgggctattgggacaggtaaaacatgtgaggctaaagac
gctaataatatatgttctttgattcgaaaattaataggtttcgatgatgtgattattcaa
tatggaggatcagttaaacctaataatattgacgaaataatgtcgatgagtgatatagat
ggagtcttagttggaggggcttcattagatccaaatagttttgccagaattgcaaattat
caataa

DBGET integrated database retrieval system