KEGG   Prochlorococcus marinus MIT9312: PMT9312_1092Help
Entry
PMT9312_1092      CDS       T00297                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMT9312_1092
Enzymes [BR:pmi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PMT9312_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1003132..1004652
Genome map
AA seq 506 aa AA seqDB search
MSIQTALKKKSLGVLMHPSCIPGGRVCGTFGKGAKDWIKKLHKHGIEYWQFLPLTPTDST
GSPYSSPSSFALNPWFLDVDYLIEEGFIFISNLEELGPSNKNKNHFDFDIATNLTKKLGR
LLLQGWTSQSEERKLDFNQWISKNSWVEDYATFVVIREEFNMLPWWQWPKEFKKKNNKFL
KSWIYTKSEEILTKKLIQWHLDKQWRSIKNYAKSYNIKLIGDLPFYVSRDSADVWSNKSL
FSIFKNGDLIFQSGVPPDYFSSTGQLWGTPTYFWSKHKSTNFDWWRKRFKRQFELVDLLR
LDHFRGLAGYWRVNGNSKTAISGKWINSPGRTLLNKLKIDLGTTYLPIIAEDLGVITPDV
EKLRINFELPGMKILQFAFDGNEDNPYLPKNIDGENWVVYTGTHDNSTSISWWECLENNS
KKLIKDEYKFSEDPSWSLIKMGMETNANLFIAPIQDILSLDDSSRLNIPGTTKNNWKWKL
NRPLGEIENNIRRFSELGNNFGRTRK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcaaacagctcttaaaaaaaaatcattaggtgtactcatgcatccttcatgt
atcccaggaggaagagtatgtggaacctttggtaaaggggctaaagattggataaaaaag
cttcataagcatgggatcgaatactggcaatttttacctcttacaccaactgattctact
gggtctccatatagttcaccatctagctttgcactgaatccatggtttcttgacgtagat
tatttaatcgaagaaggttttatcttcatttctaatttagaagaattaggaccctcaaat
aaaaataagaatcattttgattttgatattgcgactaatttaacaaaaaaattaggtcgc
ctccttttgcaaggttggacttctcaatctgaagagagaaaacttgatttcaatcaatgg
attagcaagaattcttgggttgaggattatgcaacatttgttgttatcagggaggaattt
aatatgttgccttggtggcaatggcctaaagaatttaaaaaaaaaaataacaagttttta
aaatcatggatttatacaaaaagtgaagaaatacttactaaaaaattaatacagtggcat
ttagataagcaatggagatctattaaaaattatgcgaaatcatataatattaagttaatt
ggagatttacccttttatgtttctagggacagcgccgacgtatggagtaataaatcacta
ttttcaatttttaaaaatggagatttaatctttcaaagtggtgtgcctcctgattatttt
tcatcaacaggacaattatgggggaccccaacttacttttggtcaaaacataagagtact
aatttcgattggtggagaaaaagatttaaaaggcaatttgaacttgttgacttgttgaga
ttagatcatttcaggggtttggcaggttactggagagtcaatggcaattctaaaacagca
atttctggtaaatggataaattctccaggaagaacattattaaataaactaaaaattgat
ttagggactacctacctaccaattatcgctgaagatctaggagtaattacacctgatgta
gaaaaattaaggataaattttgaactacctggcatgaaaatattacaatttgcttttgat
ggaaatgaagataacccatatttacccaagaatattgacggagaaaattgggttgtttat
acaggcacccatgacaactctacttccatctcatggtgggaatgtttagaaaataactcc
aaaaaactaataaaagatgagtataaattttcggaagatccttcatggagtttaataaaa
atgggcatggaaacaaatgctaatctctttatcgctccaatccaagatatattatcttta
gatgactcaagtagattaaatatacctggtactacaaaaaataactggaaatggaagtta
aatcgccctttaggagaaatagaaaacaatattagaagatttagtgagctaggaaataat
tttggcaggacaagaaaatag

DBGET integrated database retrieval system