KEGG   Prochlorococcus marinus MIT9312: PMT9312_1113Help
Entry
PMT9312_1113      CDS       T00297                                 

Definition
DNA helicase/exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1026281..1027981)
Genome map
AA seq 566 aa AA seqDB search
MTKTTTDIEKFEYYHIFNLILGIFKFNEKKYGNFVKDAIRILLEVEKNGETIIDVDNSLI
IFEFFEDGWPNKHIDVLKNIGLIGSLNSPFVLVNRKLSLSKWSKKIERVMNLFLKKIDTD
NLMNPIIYKDDNKIDQIKNIFKYSNLVFLQGGPGTGKTTLIINLILELLRMDNFLNIGLS
APTGKATARLKEALNDKNISFSKFLDQIEFQTLHRWILNSQNKSLKLKFKLKELDIFIID
EMSMVNIDLIESVLSLLAKDCKIILVGDKNQLSPVNNCSIWNYLFEYGENSSIKSSVVNL
EKTYRNIGDIALISSLIFNNDCSLLNQKIKELEKDNNSKEVTISKSTEKDIPKDLFFSIT
SHLNKLNLSTSNLSKKKYIFDEGIDNLLLNEKDLVDKIFLDLQSYLILCEKNSGIWSVEY
LNEIVFGQKKPYDLKTLNEGVPIMCTKNNIELGLSNGDIGVIIGLKNKRKYLFRKFNDNN
EEIVALIDPSNLENVVPAIAITIHKSQGSESEKVSILWSQKYRRNQYAVKEKKDNENIFC
RDNFERRLLYTAVTRAKKFLNIYYLN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaactactacggatattgaaaagttcgaatattatcatatatttaatttaatc
ttaggtattttcaaattcaatgaaaaaaaatatggaaatttcgtaaaagatgcaataaga
attttattagaggttgaaaaaaatggtgaaactattattgatgtagataatagtttaata
atctttgaattttttgaagatggctggcctaataaacatatagatgttctaaaaaatata
ggcttgataggttcccttaattctccattcgtattagtaaatagaaaattatccctatca
aaatggtcaaaaaagatagaaagagttatgaatttatttttaaaaaaaatagataccgat
aatttaatgaacccgataatttataaagatgataataaaattgatcaaattaaaaatata
tttaaatattcaaacttagttttccttcaaggaggaccaggtacgggtaaaaccacttta
ataataaacttaatactagaactccttcgaatggataactttttaaatattggtttgtct
gctccaacaggtaaagctacagctcgtctaaaagaagctcttaatgataaaaatatttcc
tttagcaaatttctagaccaaatagaatttcaaactttacatagatggattttaaattct
caaaataaatctcttaagttgaaatttaaactaaaagaacttgatatttttataattgat
gaaatgtcaatggttaatattgatttgattgaatcagttttaagtttgctagcaaaggac
tgtaaaattattttagttggagataaaaatcaattgtctccagtaaataactgttctatc
tggaattatttgtttgaatatggtgaaaatagttcaattaaatcatctgtagtaaattta
gaaaaaacttatagaaatattggagatatagcattaattagtagtttaatatttaataat
gattgttccttacttaatcaaaagataaaagaattagaaaaagataacaattcaaaagaa
gttactatttcaaaaagtacagaaaaagatattccaaaagatctatttttttctattaca
agtcatctaaataagttaaatctttcaacttcaaatttaagtaaaaaaaaatatatattt
gatgagggtattgataatttattgcttaatgaaaaagatttagtagataagatatttctg
gatttacaaagttacttgattttatgtgaaaaaaattctggaatatggagtgttgaatat
ttgaatgaaattgtttttggtcaaaaaaaaccatatgaccttaaaactcttaacgagggt
gttccgataatgtgtacaaaaaataatattgaacttggattgtcaaatggtgatatcgga
gtaattataggtttaaaaaataaaagaaaatatctttttagaaaatttaatgataataac
gaagaaattgtcgcattaattgatccatctaatttagaaaatgttgtgccagcaatagcc
attactattcataaatctcaaggaagtgaatctgagaaagtaagcattttgtggtcacaa
aaatatagaagaaatcaatatgctgtaaaagaaaagaaagataatgaaaatatcttttgc
agagataattttgaaagaaggttactttatactgctgttacaagagcgaaaaagtttcta
aatatatattatttaaattaa

DBGET integrated database retrieval system