KEGG   Prochlorococcus marinus MIT 9312: PMT9312_1238Help
Entry
PMT9312_1238      CDS       T00297                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00900  Terpenoid backbone biosynthesis
pmi01100  Metabolic pathways
pmi01110  Biosynthesis of secondary metabolites
pmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PMT9312_1238
Enzymes [BR:pmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PMT9312_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABB50297
CYORF: PMT9312_1238
UniProt: Q319Z8
Position
1153915..1155141
Genome map
AA seq 408 aa AA seqDB search
MKYITVLGSTGSIGTQTLEIASEQPDKFKAVALSAGRNITLLTEQVKTHKPEVVAIEDEN
LIEDLKDNINNLDLDSAPLVLGGKEGINAVAAWDKADTVITGIVGCAGLIPTMSAINAGK
NIALANKETLIAAGPIVIPALKKNNSRLLPADSEHSAIFQCLQGLPNYENADFSTGVMPK
GLKAIHLTASGGAFRDWPVENLKHVTVEDATSHPNWDMGKKITVDSATLMNKGLEVIEAH
YLFGTSYENIEIVIHPQSIIHSMIEMEDSSVLAQLGWPDMKLPILYAMSWPERFKTNWKR
LNLSEIGKLTFKEPDEFKYPCMGLAYAAGKSSGTMPAVLNAANEMAVEQFLKEKISFQEI
PTFISKACESHMENLNLSPELEDILEVDNWARIFVKQEIKKGKKYVSI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacattactgttctcggttctactggttcaatagggactcagactctcgaaata
gctagtgagcagcctgataagtttaaagccgtagctctttcggcaggacgaaatattact
ttattaactgaacaagttaaaacacataaaccagaagtagttgcaattgaggatgaaaat
cttatagaagatttaaaagataatattaataacttagatttggatagtgctcccttggtt
ttgggtggaaaggaggggattaacgcagttgcagcttgggataaggcagatacagttata
accgggatagtaggatgtgcaggcttaattccaacaatgtcagcaattaatgcggggaaa
aatattgcccttgctaacaaagaaactttaattgcagcagggccaattgttattcctgca
ttaaagaaaaataatagtaggcttttacctgctgattcagaacactctgctatctttcaa
tgcttacaaggattacctaattatgaaaatgcagatttttcaacaggagtgatgcctaag
ggtttaaaagccatacatttaacagcttctggtggtgctttcagagattggcccgttgag
aatttaaagcatgtcacagtggaagatgcgacttcacatcctaattgggatatgggaaaa
aaaataactgtagattctgcaactcttatgaataaaggattagaagttatagaagctcat
tatttatttgggacctcttacgaaaatatcgaaatagttattcaccctcaaagtattatt
cattcaatgattgagatggaagattcttcagtattagctcaattaggttggccagatatg
aagctacctattttatatgcgatgagttggcctgaaaggtttaaaacaaattggaaaaga
ttaaacctaagtgaaattggaaaattaacttttaaagagccagacgagtttaaatatcca
tgcatgggacttgcttatgccgcaggaaaatcttcagggactatgcctgcagtcttaaat
gctgctaacgaaatggctgttgaacaattccttaaagaaaaaatttcttttcaagaaatt
ccaacatttataagtaaagcttgtgaatcacatatggagaatttgaatttgagtcccgaa
ttggaggatattcttgaagtggataattgggccagaattttcgttaagcaagaaataaaa
aaagggaaaaaatacgtaagtatttga

DBGET integrated database retrieval system