KEGG   Prochlorococcus marinus MIT9312: PMT9312_1293Help
Entry
PMT9312_1293      CDS       T00297                                 

Definition
CysQ protein-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pmi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1200522..1201418)
Genome map
AA seq 298 aa AA seqDB search
MIKLPFGVEINNLIDNLKSLSWEAADILLYYANIIKKLEQKNEILKNKNNNDPVTLADLE
VNELIINRINQKYQDTNWEILSEENFKIESNYFNNVDWLWVLDPLDGTKDFIQGTQNYAM
HLALNYKRRPFIGVVLIPEKDELWISYAEKLWCEKRDGSIRKQNLSETDILKDMTIVTSK
NHRNEKLKDLIEKINFKKTIVMGSIGCKVASIIRGDSDIYIALSLPGKSAPKDWDFAAPE
AILKAAGGSITNIDNEDLVYGSTDLKHSGIIIASNNKKNHKRICSQVKEIIEEYKIYP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaattacctttcggagtagaaattaataatctaatagataatctgaagagtttg
agttgggaagctgcagatatcttgttgtactatgccaatattattaaaaaattagagcaa
aaaaatgaaattcttaagaataaaaataataatgaccctgtaacattagctgatttagaa
gtaaacgaattaattattaacagaataaatcaaaaatatcaagatactaattgggagatc
ttgagcgaagaaaatttcaaaatagaatccaattattttaataatgttgactggctttgg
gttcttgatcctctagacggaactaaagattttattcaaggaacacaaaattatgctatg
catttagccttgaactataaaagaaggccatttattggggttgtgcttatccccgaaaaa
gatgaattatggatttcttatgcagaaaaactttggtgtgagaaaagagatggaagtatt
cgaaaacaaaatttgtctgaaacagatattctcaaagatatgaccatagttaccagtaag
aaccacaggaatgaaaaattaaaggatttaattgaaaagattaattttaagaaaactatt
gtaatgggtagtattggttgcaaagttgcttcaattattagaggagatagtgatatttat
attgcattgagtttgccaggcaaaagtgcgccaaaagattgggattttgctgcaccagaa
gctattttaaaagcggctgggggatcaataacaaatattgataatgaggatttggtttat
ggtagtactgatcttaagcattcaggtattataattgcctctaataacaagaagaatcat
aaaagaatctgctcgcaagtaaaagaaattattgaggaatataaaatttatccttag

DBGET integrated database retrieval system