KEGG   Prochlorococcus marinus MIT9312: PMT9312_1324Help
Entry
PMT9312_1324      CDS       T00297                                 

Definition
asparagine synthase (glutamine-hydrolysing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PMT9312_1324
Enzymes [BR:pmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PMT9312_1324
Peptidases [BR:pmi01002]
 Cysteine Peptidases
  Family C44
   PMT9312_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1236769..1238637
Genome map
AA seq 622 aa AA seqDB search
MCGITGIISFQSSIDPQNIHNMNETLMHRGPDHRDIWINEYSTVFLGHTRLSILDLSDNG
NQPFHSKDGRFHLTFNGEIYNYKNLKDYLKTNGISNFKSNSDTEVLIELIALRGITNASK
MLNGMFAFAVWDSLEKKIHLVRDRFGEKPLFYTLQKDTLYFGSEIKSILKIPTISKIINK
EALSHYLRFNYIKNPLTIYKDIYKLEPGHILSIDQNITYKKYSYKNKNKKTIKLANQKEA
EDLLQNQIIKSCLSRTISDVPIACFLSGGIDSSLVTSIIQRNSKQRIKTFTIGFDDQSID
ESNYAEKIANFLGTDHTTINIEEKELLNNIDLQSEIYGEPFADQSSIATNILCKYASRDV
KVCLSGDGGDEMFIGYDRYYKVNQLRLFLKAIKFYKKFKTIDRILEVLIHKIESNKNFSI
KIDKIIKLISLLSDANDDNIYEKFNSLYRDQYFPLTPQNNQKHYIYKDLKNIQEMCEYDF
ETYLPDCILTKVDRASMHNSLEVRAPFLDHEIPEIIDSINPTYKKKLLNRKFILKKLLNK
YLPKNIYERPKKGFSAPLNNWIKGPLKELTLDYLSIESLKKHNLLDIDIIERIKYEHYSG
IRSWHNQIWNLLIFQQWYNKNF
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtataacaggaattatctcatttcaaagtagtatagatcctcaaaatattcac
aatatgaatgagactctcatgcatagagggcctgatcacagagacatatggattaatgaa
tatagtactgttttccttggtcatacaagattatccatattagatttatctgacaatggg
aatcaaccttttcatagtaaagatggtagatttcacttaacttttaacggtgaaatatac
aattataaaaatcttaaagattatctcaaaacaaatgggatttcaaatttcaaaagtaat
tcagatacagaagtattaattgaacttatagctttacgtggaataacaaatgcttcaaaa
atgcttaatggaatgtttgcatttgcagtttgggactctttagaaaaaaaaatacatctt
gtaagagatagatttggtgaaaaaccattattttatactctccaaaaagatactttatat
tttggatcagaaattaaatcaatattaaaaatacctacaatatcaaaaataattaataaa
gaagctttgtctcattatctgaggtttaactacattaaaaatccattaacaatatataaa
gatatttataaattagagccaggccacattttaagcattgatcaaaatattacttacaaa
aaatacagttacaaaaataaaaataaaaaaacaatcaaattagctaatcaaaaagaagca
gaagatttactacaaaatcaaattataaaaagttgtttgtcaagaacaatatcggatgtt
cccattgcttgttttttatcgggaggcatagattcttctttagttacaagtattattcaa
aggaactcaaaacaaagaattaaaactttcactatcggttttgatgatcaatctatagat
gaatctaattatgctgaaaaaatagcaaattttttgggaactgatcatacgactataaat
attgaagaaaaagaattattaaataatattgatttacaaagtgagatttatggagaaccg
tttgcagatcaatcatccattgcaacaaacattctatgtaaatatgcttcaagggatgtc
aaagtatgtcttagtggagatggcggagatgaaatgtttattgggtacgatagatactac
aaagtaaaccaattaaggttattcctaaaagcaataaaattttataaaaaatttaaaaca
attgatagaattttggaagttttgattcacaagattgaaagtaataaaaacttttctata
aagattgacaagataattaaattaatcagtctattatcagatgcaaatgatgataatatt
tatgaaaaattcaactcattatatagagatcaatatttcccattaactcctcagaataat
caaaaacattatatatataaagatttaaaaaatattcaagaaatgtgtgaatatgatttt
gaaacttatctacctgattgtattttaactaaagttgatagagcaagtatgcataattca
ttagaagtaagggccccttttcttgaccatgaaattcctgaaattattgactctattaat
cctacatataaaaaaaaattactaaatagaaaattcatattaaaaaaattattgaataaa
tatcttcccaaaaatatatatgaaaggccaaaaaaaggatttagcgctcctcttaataat
tggataaaaggtccactcaaagaacttactttagattatttatctattgaatctttaaag
aaacataatttattagatattgatattattgaaagaatcaaatatgaacattattctggg
ataaggtcttggcataatcaaatatggaaccttttgatttttcaacaatggtataataaa
aatttttaa

DBGET integrated database retrieval system