KEGG   Prochlorococcus marinus MIT9312: PMT9312_1396Help
Entry
PMT9312_1396      CDS       T00297                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1310453..1311823
Genome map
AA seq 456 aa AA seqDB search
MICGSKKKAYLKSQNLKILGQGKLNGIVKINGAKNSALVLLASSLLTNEKIILENIPYLT
DIEKMGNILKNLGVNLIDKNDQLEIDPTNISIKELPYELVNGLRASFFCIGALLTKFGEA
QVPLPGGCNIGSRPIDEHINGLIALGADIIIEEGIVKAKIRGNKNKLHGTHIKLKCPSVG
ATETLIMAASLAEGRTTIENAAREPEIQDLCHMLNKMGAKIYDSGKETIIIDGVNKLGGC
THKVIPDRIEAGTFLIAAAATSSSITISPVIPHHLEAVTNKLQESGSKITIKGNSISIKS
KEIKGVDIETAPFPGFPTDLQAPFTALMTIANGESKITETIFENRMNHIHLLNKMGARIK
LNENVAYIKGVKTLNGMDLIGSDLRSSAALIIAGIIAEGTSNIYGLEHLDRGYENFELKL
KKLGIKITREFNKSTFEENEFKIEPKSEDISNLRAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcggaagcaaaaagaaggcatatcttaaatcgcaaaatttaaagattcttggc
caaggcaagttaaatggaatagttaagataaatggcgcgaagaattcggccttagtttta
ttggcatcatcattgctaactaatgaaaaaataatacttgaaaatattccttatcttact
gatattgagaaaatgggaaatatcctaaaaaatttaggagttaatttaattgataaaaat
gaccaattagagatagatccaacaaatatttccattaaagaacttccatatgaactagtt
aatggattaagagctagtttcttttgcataggtgcactattaactaaatttggagaagct
caagtacccttaccaggtggatgcaatattggatcaaggccaatagacgagcacattaat
ggactcatcgcattaggcgcagacattattattgaagagggaattgtcaaggcaaagata
aggggaaacaaaaataaacttcatggtactcatattaaattgaagtgtccaagcgtagga
gcaactgaaactttaataatggctgcatctttagcggaaggaagaactactattgagaat
gctgcaagagagcctgaaattcaggatttatgccatatgcttaataaaatgggggcaaag
atttacgactccggtaaagaaacaataattattgatggtgttaataagctaggtggttgt
actcataaagtaattccagaccgaatagaagctggaacttttctaatagctgctgctgca
acttcctcttcaataacaatttctcctgtgatccctcatcatcttgaagctgttactaat
aagcttcaagaaagtgggagtaaaattactattaaaggtaattcgatttcaatcaagagt
aaggagattaaaggagtagatattgaaacagctccttttccaggatttcctactgatttg
caagcaccatttacagcactaatgacaatagcaaatggtgaatcaaagatcactgaaacg
attttcgaaaacagaatgaatcatattcatttacttaataaaatgggtgcccgtataaaa
ctaaatgaaaacgtagcttacattaaaggtgttaaaacacttaatgggatggatctaata
ggctcagatttaaggtcatcagccgcattaataattgctggaatcatcgcagaaggtact
agtaatatctatggtttagaacatttagatagaggttatgaaaattttgaattaaaacta
aaaaaattaggtattaaaataactagggagtttaataaaagtacttttgaggagaatgaa
tttaaaattgaacctaaatctgaagacatttcaaatcttagagcagcttag

DBGET integrated database retrieval system