KEGG   Prochlorococcus marinus MIT9312: PMT9312_1581Help
Entry
PMT9312_1581      CDS       T00297                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pmi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1476862..1478184
Genome map
AA seq 440 aa AA seqDB search
MGREPFNLKNLEMRIINNKKDAIQELKRISSRTNSENNNKINLIVEEILQEVKTYGDIAV
EKYTKKFDGFNPDPMQISEDHLKDAWDEIDSNLKRSLEVAHKRIKKFHEKEIPQSFTIKG
EHGDTVQRRWRPVKNAGIYIPGGRAAYPSTVLMNAIPAKVAGVEEIIMVSPGNKEGEINK
TVLAAAHLSGIKKVFRIGGAQAIGALAFGTNQINKVDVITGPGNIYVTTAKKLIYGSTGI
DSLAGPSEILVIADETAQSTHIASDLLAQAEHDPLASSILLTTSKNQAKEVLEELYKKID
DHPRKEICMQSIKNWGLIVICENYELCIELSNNFAPEHLEILALDSKKILEGIENAGAIF
LGKWTPEAVGDYLAGPNHTLPTSGNSRFSGSLGVETFMKNTSIIEFNEESLKVNSLDIIN
LAESEGLHSHANSVKIRFED
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgggtcgcgagcctttcaatttgaaaaatttagaaatgaggattataaacaataaaaaa
gacgctatccaagaattaaaaaggatttcttctagaactaattcagaaaacaataacaag
ataaatctaatcgtcgaagaaattcttcaagaggtaaaaacttatggggatatagcagtt
gaaaaatataccaaaaagtttgatggtttcaaccctgaccctatgcaaattagtgaggat
cacttaaaggatgcatgggatgaaattgatagcaatttaaagcgctcacttgaggtggcc
cataaaagaattaaaaaattccatgaaaaggaaattccacaatctttcactataaaaggt
gaacatggtgatacagttcaaaggagatggagaccagttaaaaatgcaggtatttatatt
cctggaggcagagctgcttatccaagtactgtattaatgaatgcaatacctgcaaaagta
gcaggagtagaagaaattataatggtatctcctggaaataaagaaggggaaataaacaaa
actgttttagctgcagctcacttatcagggatcaaaaaagtttttagaattggaggagct
caagctattggtgctttggcatttggcacaaatcaaattaataaagttgatgttattaca
ggtccagggaatatctatgtaactactgctaaaaaactaatttatggctctacaggcatt
gattctttagctggtcctagtgaaatattagtcattgcagatgaaacagctcaaagcact
catatagcttctgatctcttagcgcaagcagaacatgatcctttggcttcatcaatactt
ctaacaacatcaaagaaccaagcgaaagaagttttagaggaactttataaaaaaatagat
gatcatccaagaaaagaaatttgcatgcaatccataaaaaattggggattaatagttatt
tgcgagaattatgaattatgtatcgaactgagcaataactttgctccagaacatttagaa
attttagctttagattcaaaaaagattcttgaaggtatagagaatgcaggagcaatattt
ttaggaaaatggaccccagaagcagtaggagattatctggctggaccaaatcatacttta
cctacatcaggaaattctagatttagcggttctttaggagttgaaacttttatgaaaaac
acttcaataatagaatttaatgaagaaagtttaaaagtcaacagtctcgatattattaat
cttgctgagagtgagggcttacatagtcatgccaactcagtaaaaataagatttgaagat
tag

DBGET integrated database retrieval system