KEGG   Prochlorococcus marinus MIT9312: PMT9312_1764Help
Entry
PMT9312_1764      CDS       T00297                                 

Definition
Fatty acid desaturase, type 1 (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PMT9312_1764
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PMT9312_1764
Enzymes [BR:pmi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PMT9312_1764
Lipid biosynthesis proteins [BR:pmi01004]
 Desaturase
  First
   PMT9312_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1656076..1657014
Genome map
AA seq 312 aa AA seqDB search
MNSVIFQETAKLKKPVPAEKVIELSEKLVEPSRHSKKYPPRLHKTWGTIVFMVAIHILSL
IALQPKFWSLPAVTSLLFFYWVTACLGVTLGYHRLLSHRSFIVPRWLERFFATCGAISCQ
HGPIDWVGLHRHHHSFSDTEVDHHNSKKGFWWSHMGWMFKDVEALKAVPKLSADLIKDPY
YRFLNKYFLFLQIPIGLSLFAIGQKLGVGGWALVLWGIPLRLVVVYHITWLVNSATHCWG
KAPFESGDSSKNNAWVAALTFGEGWHNNHHAFPNSAKQGLFRGQIDITWEHIKILAKFGL
AKKVKLPSRSYY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagtaattttccaagaaacagcaaaattaaaaaaacctgttccagctgaaaaa
gttatagaactctcagaaaaattagtagaaccttcccgccattcaaaaaaatatcctcca
agacttcataaaacttggggaacaatagttttcatggttgcaattcatattctttccctt
atagctttacaaccaaagttttggagtctacctgcagtcacatcattattatttttttac
tgggtaactgcttgtttaggagtcactcttggatatcacagattgttatcacacagatcg
ttcattgttccaagatggttagaaagattttttgctacctgcggagctataagttgccag
catggacctattgattgggtgggtttacataggcatcaccactccttttcagatacagaa
gtagatcatcacaatagtaaaaaaggtttttggtggagtcatatgggttggatgtttaaa
gacgttgaagcactgaaagctgtaccaaaactaagtgcagatttaattaaagatccatac
tatagattcctaaataaatattttttatttttgcaaattcctattggactttctttgttc
gcaataggtcaaaaattaggagttggtggttgggctttggtgctatggggaattccattg
agacttgtagtcgtttatcacataacctggctagtaaattcagccactcattgttggggt
aaggcaccatttgaaagtggtgactcatccaaaaataatgcgtgggttgctgcattaaca
tttggagaaggttggcataataatcatcatgcattccccaattctgcaaaacaaggatta
tttagaggtcaaatcgatataacttgggaacatattaagattcttgcgaaatttggtctt
gcaaaaaaagtaaagttaccctctaggtcttattattaa

DBGET integrated database retrieval system