KEGG   Prochlorococcus marinus MIT 9312: PMT9312_1808Help
Entry
PMT9312_1808      CDS       T00297                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00260  Glycine, serine and threonine metabolism
pmi00750  Vitamin B6 metabolism
pmi01100  Metabolic pathways
pmi01110  Biosynthesis of secondary metabolites
pmi01120  Microbial metabolism in diverse environments
pmi01230  Biosynthesis of amino acids
Module
pmi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMT9312_1808
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PMT9312_1808
Enzymes [BR:pmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PMT9312_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF438
Motif
Other DBs
NCBI-ProteinID: ABB50870
CYORF: PMT9312_1808
UniProt: Q317S5
Position
1707966..1709069
Genome map
AA seq 367 aa AA seqDB search
MVLLNKIKNKLRINYRKKRWPGLIDAYKQYLPVTKKTPIISLNEGNTPLIFSDSISKLIG
NGTKVFLKYDGLNPTGSFKDRGMTMAISKAKEEGREAVICASTGNTSAAAAAYASRGGLK
PYVLIPEGFVAQGKLAQALMYGAEIISINGNFDKALEIVRDLSAEHPIELVNSVNPYRIQ
GQKTAAFEIVDDLGIAPDWLCIPMGNAGNITAYWMGFKEYSKIKRNLKLPIMMGFQSEGS
APLVQNIIIKEPETIATAIRIGNPVNREKAKKVKKESKGDFQSVTDEEIINAYKILAKEG
VFCEPASAASVAGLIKNKNRIQKESTIVCVLTGNGLKDPDCAINNNDAIFRKNIEPSLKN
ITKILGY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgttattaaataaaattaagaataaattacggatcaattacagaaaaaaaagatgg
cctggtctaattgatgcttataaacaatatcttccagttacaaaaaaaactccaattatc
tcactaaacgaaggaaatactccactaatttttagtgactcaattagcaaattgattgga
aatggaactaaggtttttttaaaatatgatggtttaaaccctacaggatcttttaaagat
cggggaatgactatggccattagcaaagcaaaagaagaagggcgtgaagctgtaatttgt
gcaagcactggaaacacttctgctgctgctgctgcatatgcttctagaggaggattaaaa
ccttatgttttaatcccagaaggatttgttgcacaaggaaagcttgcacaagctttaatg
tatggtgctgagataatatctattaatgggaactttgataaagctctagaaattgtaaga
gatttatctgctgaacatccaatagaacttgttaattctgttaatccctatcgaatacaa
ggtcaaaagactgcagcctttgaaattgttgatgacttaggtattgcacctgattggctt
tgtattccaatgggtaatgcaggaaatataactgcttattggatggggtttaaagaatat
tcaaaaataaaaagaaatttaaaattaccaattatgatgggttttcaatccgaaggctct
gcaccactagtgcaaaatataataattaaagaacccgagacaattgcaacagcaataaga
attggcaatcctgttaatagagaaaaagcaaaaaaagtaaaaaaagaaagtaaaggagac
tttcaatcagttacggatgaagaaataatcaatgcttataaaatacttgctaaagaggga
gtgttttgtgaacctgccagtgcagcatcagttgctggattaattaaaaataaaaataga
attcaaaaagaatcaactattgtttgtgttcttactggaaatggcttgaaagaccctgat
tgcgctattaataacaatgatgctattttcaggaaaaatattgaaccttcgttaaaaaat
ataactaaaattttaggatattaa

DBGET integrated database retrieval system