KEGG   Prochlorococcus marinus MIT9312: PMT9312_1808Help
Entry
PMT9312_1808      CDS       T00297                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmi  Prochlorococcus marinus MIT9312
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMT9312_1808
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMT9312_1808
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PMT9312_1808
Enzymes [BR:pmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PMT9312_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1707966..1709069
Genome map
AA seq 367 aa AA seqDB search
MVLLNKIKNKLRINYRKKRWPGLIDAYKQYLPVTKKTPIISLNEGNTPLIFSDSISKLIG
NGTKVFLKYDGLNPTGSFKDRGMTMAISKAKEEGREAVICASTGNTSAAAAAYASRGGLK
PYVLIPEGFVAQGKLAQALMYGAEIISINGNFDKALEIVRDLSAEHPIELVNSVNPYRIQ
GQKTAAFEIVDDLGIAPDWLCIPMGNAGNITAYWMGFKEYSKIKRNLKLPIMMGFQSEGS
APLVQNIIIKEPETIATAIRIGNPVNREKAKKVKKESKGDFQSVTDEEIINAYKILAKEG
VFCEPASAASVAGLIKNKNRIQKESTIVCVLTGNGLKDPDCAINNNDAIFRKNIEPSLKN
ITKILGY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgttattaaataaaattaagaataaattacggatcaattacagaaaaaaaagatgg
cctggtctaattgatgcttataaacaatatcttccagttacaaaaaaaactccaattatc
tcactaaacgaaggaaatactccactaatttttagtgactcaattagcaaattgattgga
aatggaactaaggtttttttaaaatatgatggtttaaaccctacaggatcttttaaagat
cggggaatgactatggccattagcaaagcaaaagaagaagggcgtgaagctgtaatttgt
gcaagcactggaaacacttctgctgctgctgctgcatatgcttctagaggaggattaaaa
ccttatgttttaatcccagaaggatttgttgcacaaggaaagcttgcacaagctttaatg
tatggtgctgagataatatctattaatgggaactttgataaagctctagaaattgtaaga
gatttatctgctgaacatccaatagaacttgttaattctgttaatccctatcgaatacaa
ggtcaaaagactgcagcctttgaaattgttgatgacttaggtattgcacctgattggctt
tgtattccaatgggtaatgcaggaaatataactgcttattggatggggtttaaagaatat
tcaaaaataaaaagaaatttaaaattaccaattatgatgggttttcaatccgaaggctct
gcaccactagtgcaaaatataataattaaagaacccgagacaattgcaacagcaataaga
attggcaatcctgttaatagagaaaaagcaaaaaaagtaaaaaaagaaagtaaaggagac
tttcaatcagttacggatgaagaaataatcaatgcttataaaatacttgctaaagaggga
gtgttttgtgaacctgccagtgcagcatcagttgctggattaattaaaaataaaaataga
attcaaaaagaatcaactattgtttgtgttcttactggaaatggcttgaaagaccctgat
tgcgctattaataacaatgatgctattttcaggaaaaatattgaaccttcgttaaaaaat
ataactaaaattttaggatattaa

DBGET integrated database retrieval system