KEGG   Proteus mirabilis BB2000: BB2000_0635Help
Entry
BB2000_0635       CDS       T02789                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase E1 component
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pmib  Proteus mirabilis BB2000
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmib00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BB2000_0635 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB2000_0635 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    BB2000_0635 (sucA)
   00380 Tryptophan metabolism
    BB2000_0635 (sucA)
Enzymes [BR:pmib01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BB2000_0635 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
725307..727862
Genome map
AA seq 851 aa AA seqDB search
MDSKQVKVLQLINAFRFRGHQNANLDPLGLWKRESVPDLDPAFHNLTKEDFEETFNVGSF
AIGKETMKLGDIYEALKRIYCGSIGAEYMHITNTEEKRWIQQRLESVNVADQFTKEEKIR
FLAELTAAEGLERYLGAKFPGAKRFSLEGGDALIPMLKDLIRHAGKQDTREVVLGMAHRG
RLNVLVNILGKKPADLFDEFAGIHKEHLGTGDVKYHQGFSSDFATEGAQVHLALAFNPSH
LEIVSPVVIGSVRARRDRLDEARSNMVLPITIHGDAAVTGQGVVQETLNMSQARGYEVGG
TVRIVINNQVGFTTSNPKDARSTEYCTDIVKMVQAPIFHVNADDPEAVAFVTRLALDFRN
TFKRDVMIDLVCYRRHGHNEADEPNATQPLMYQKIKKHPTPRKIYADKLVEQGLIEANDV
TELVNLYRDALDRGDCVVEEYRPMGLHSYTWEPYLNHEWNEEYPHKVEKSRLQDLARRVS
TVPSEIAMQSRVEKIYADRAVMAEGEKLLDWGAAETLAYATLVDQGITIRLSGEDAGRGT
FFHRHAVIHNQTNGSVYVPLANIHNAQGQFNVWDSVLTEEAVLAFEYGYATTEPRGLTIW
EAQFGDFANVAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCA
EQNMQVCVPSTPAQVYHMLRRQALRGMRRPLIVMSPKSLLRHPLAVSSLDELADGKFLPV
IGELDELNPADVKRVVMCSGKVYYDLLEQRRANGQTDVAIIRIEQLYPFPHDDMAQILAP
YAHVKDFIWCQEEPLNQGAWYCSQHNFRDAIPTGATLRYAGRPASASPAVGYTSVHQEQQ
KALVEDALKVE
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggactcaaaacaagttaaagttttgcagctcattaatgcgtttcgttttcgtggtcat
caaaatgctaatctcgatccgcttggtttatggaaaagagaatctgttccagatttagat
cctgctttccataatctcaccaaagaagattttgaagaaacctttaatgttggttctttt
gctatcggcaaagaaaccatgaaactcggtgatatctatgaagcactgaaacgtatttac
tgcggttctatcggtgctgaatatatgcatattaccaatacagaagaaaaacgttggatc
caacaacgtttagaatctgtcaatgttgcagaccaatttactaaagaagaaaaaattcgc
tttttagcagaactgactgcagctgaagggttagaacgttacttaggggctaaattccca
ggagcaaaacgtttctctttagaaggtggggatgctctgatcccaatgttaaaagactta
attcgtcatgcagggaaacaagatacccgtgaagtggtacttggcatggctcaccgcgga
cgtttaaacgttctggttaatattttagggaaaaaaccggcagatttatttgatgaattt
gcgggtatacacaaagagcatttgggaactggtgacgttaaatatcaccaaggcttttca
tctgattttgcaacagaaggtgctcaagttcaccttgctttagcctttaacccatctcac
ttagaaattgtgagtcctgttgttatcggttctgtccgtgctcgtcgtgaccgcttagat
gaagcgcgcagtaatatggttcttccgatcaccattcatggtgacgcagcagtgacaggg
caaggtgttgttcaagaaacactgaacatgtcacaagctcgcggttatgaagttggtggt
acggttcgtatcgttattaataaccaagttggttttaccacatcaaatcctaaagatgcc
cgttcaacagaatactgcactgatattgtgaaaatggttcaagcgcctattttccacgta
aatgcagatgatcctgaagcggtagctttcgtcacccgtttagcgttggatttccgtaat
acctttaagcgtgatgtgatgattgaccttgtttgttatcgtcgtcatggacataacgag
gcggatgagccaaatgcaactcagccattgatgtatcaaaaaatcaaaaaacatccaaca
cctcgtaagatctatgctgataagttagtagagcaaggtttaatcgaagctaatgatgtt
actgagttagttaatctctatcgtgatgctctcgatcgtggtgattgtgtcgttgaagag
tatcgtcctatggggctacattcttatacatgggaaccttacttaaaccatgaatggaat
gaagagtatccgcataaagtcgaaaaatcacgcttacaagatttagcgcgtcgtgtcagc
acagtaccttctgaaatcgcaatgcaatctcgcgtcgagaaaatttatgccgatcgtgct
gttatggctgaaggcgaaaaattactcgattggggggcggctgaaaccttagcgtatgcc
actttagtggatcaaggtattactattcgcctctctggtgaagatgctggccgtggcaca
ttcttccatcgtcacgcggttattcacaatcaaaccaatggttcagtttatgtaccatta
gccaatattcataacgcccaaggtcaatttaatgtttgggattctgtcttaacagaagaa
gcggtattagcatttgaatatggttatgccactactgagcctcgcgggctgactatttgg
gaagcgcaatttggtgactttgctaacgtagcacaagtggttatcgaccaatttattagc
tctggtgagcaaaaatggggtcgtatgtgtggcttagtcatgctgttacctcatggttat
gaaggtcaagggccagagcactcatctgcacgtttggaacgctatctgcaattatgtgca
gagcaaaacatgcaagtttgtgtgccttccacaccagcgcaggtttaccatatgttacgt
cgccaagcgttacgtggcatgcgtcgcccattaatcgttatgtcacctaaatcactgtta
cgtcatccattagcggtatcgagcttagatgaattagcggatggtaaattcttacctgta
attggtgagttagatgaattaaatccagcggatgtgaaacgtgtcgtgatgtgttcaggg
aaagtttactacgatttattagaacaacgtcgtgctaatgggcaaacagatgttgcgatt
attcgtattgaacagctatatccattccctcatgatgatatggcacagattttggcacct
tatgctcatgtgaaagattttatttggtgtcaagaagaaccgctaaatcagggcgcttgg
tattgtagtcagcataacttccgtgatgctattcctactggcgcaacattacgttatgca
ggtcgtcctgcatcagcttctccagctgttggttatacctctgttcatcaggagcaacaa
aaagctctggttgaagatgcactgaaagttgaataa

DBGET integrated database retrieval system