KEGG   Proteus mirabilis BB2000: BB2000_1296Help
Entry
BB2000_1296       CDS       T02789                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pmib  Proteus mirabilis BB2000
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pmib00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmib00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1434871..1436187)
Genome map
AA seq 438 aa AA seqDB search
MSYFDKIEQIQYEGTTSDNPLAFRYYNPDEIILGKRMEDHLRFAACYWHNFCWNGSDMFG
IGTFDRPWQTPGEALEQAKRKADVAFEFFHKLNVPFYCFHDVDVISEGNSINEYITNMAA
ITEVLAQKQQETGVKLLWGTANCFTHPRYGAGAATNPDPEVFAWAATQVCEAMKATKTLG
GENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTKH
QYDYDTATVYGFLKQFGLEKEVKVNIEANHATLAGHSFHHEIATAIALGILGSVDANRGD
PQLGWDTDQFPNSVEENALVMYEILKSGGFTTGGLNFDAKVRRQSNDKYDLFYGHISGMD
TMAMALRIAAKMIQDGGLDKFIAQRYAGWSAELGQNILQGKLSLEEVAKYAQSNTLAPPL
QSGRQEMLESLVNRYIFG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactttgataaaattgaacaaattcaatatgaaggtaccaccagcgataaccct
ctcgcttttcgctactataatccagatgaaattattttagggaaaagaatggaagatcat
ctgcgatttgctgcctgctattggcataacttctgctggaatggttcggatatgtttggt
attggtacgtttgatagaccttggcagacaccgggagaagcactagaacaagcaaagcgt
aaagcggatgttgcttttgaatttttccataaactcaatgtacctttttactgttttcat
gatgttgatgttatctctgaaggaaatagcattaatgaatatatcaccaatatggcagca
ataactgaggtattagcgcaaaaacagcaagaaacgggcgttaaattattgtggggaact
gcaaattgttttactcatcctcgttacggagctggtgctgcaacaaatcctgatccagaa
gtatttgcttgggcggcaactcaagtttgtgaagcgatgaaagcaacaaaaacgctggga
ggtgaaaactatgtgttatggggaggccgcgaaggttacgaaacattattaaatacagat
ttacgccaagagcgggaacaaattggtcgttttatgcagatggttgttgagcataaacat
aaaattggattccaaggtacactgctcattgagccgaagccacaagagccaactaagcat
caatatgattatgatactgcgacagtttatggtttcttaaaacaatttggtttagaaaaa
gaagttaaagtgaacatagaagctaaccatgcaactttagcgggtcatagtttccatcat
gaaatcgccacagctattgcattaggtattttaggctcagtcgatgctaaccgaggtgat
ccacaattaggttgggacacagaccaatttcccaatagtgtagaagaaaatgcattagtt
atgtatgaaattctcaaatccggtggttttacgactggtggattaaactttgatgccaag
gtacgtcgtcaaagtaatgataaatacgatcttttctatgggcatatatccggaatggac
accatggcaatggcattacgtattgcagcaaaaatgatccaagacggtggacttgataaa
tttattgctcaacgttatgcgggatggagtgctgaacttggccaaaatatcctacaaggc
aaattaagtcttgaagaagtggcaaaatatgcacaaagcaataccttagcgcccccctta
caaagcgggcgtcaagagatgctagagagtttagtgaatcgttatatttttggttaa

DBGET integrated database retrieval system