KEGG   Proteus mirabilis BB2000: BB2000_1519Help
Entry
BB2000_1519       CDS       T02789                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pmib  Proteus mirabilis BB2000
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmib00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BB2000_1519 (tdk)
Enzymes [BR:pmib01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BB2000_1519 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1661190..1661786)
Genome map
AA seq 198 aa AA seqDB search
MAQLYFYYSAMNAGKSTSLLQSSYNYNERGMRTLIFTAAIDTRFAKGKVTSRIGLSADAL
LFSDDMNIRDAILAENNKEPIHCVLIDECQFLTKAHVEQLCEITDSYDIPVLTYGLRTDF
RGELFTGSAYLLAWADKLVELKTVCYCGRKANKVLRLAANGKVLSDGAQVEIGGNEKYVS
VCRKHYTEATLKGRIEQL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctcagctttacttttattattcagctatgaatgccggaaaatcaacatctttattg
cagtcttcttataactataatgagcgaggaatgcgaactttgatttttacggcagcgata
gacacgcgttttgccaagggaaaagtaacctcaaggatagggttaagtgctgatgcattg
cttttcagtgatgatatgaatattcgtgatgctattttagctgaaaataataaagagcct
attcattgtgttttgattgatgaatgccaatttttgactaaagcacatgtagaacaactt
tgtgaaattaccgatagttatgatatacccgttttaacctatggcttaagaacggatttt
agaggtgaattatttaccggtagtgcttatttgcttgcatgggctgacaagctcgttgag
cttaaaacagtttgttactgcgggcgtaaagcaaataaagtattacgattagcggcaaat
gggaaagtactttcagacggcgcacaagtggaaataggtggtaatgaaaaatatgtttca
gtgtgccgcaaacattatacagaggctacgttaaaaggacgaattgaacagttataa

DBGET integrated database retrieval system