KEGG   Proteus mirabilis BB2000: BB2000_2552Help
Entry
BB2000_2552       CDS       T02789                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
pmib  Proteus mirabilis BB2000
Pathway
pmib00240  Pyrimidine metabolism
pmib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmib00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BB2000_2552 (deoA)
Enzymes [BR:pmib01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BB2000_2552 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Phi-29_GP16_7
Motif
Other DBs
NCBI-ProteinID: AGS61007
Position
complement(2776371..2777693)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHPLTEEEIRFFINGVRDNTVSEGQIAALAMTIYFHDMTMPERVALT
LAMRDSGTVLNWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDEKFRDIIRHVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILGKKLAEGLDALVMDVKVGSGAFMPTYQKSEELAESIVQVANGAGCQTTALLT
DMNEVLASSAGNAVEVREAVQFLTGEYRNPRLFEVTMALCVEMLVSGRLADSRQQARQKL
QDVLDNGKAAEVFARMVAAQNGPTDFVENYNKYLPTAVLSKPVFAEKAGFVTEMDTRALG
MSVVTLGGGRRKATDAIDYSVGLSEIAALGTEINTDTPLAMIHANSEKSWQEAAAEVRKA
MVIGETKRETSPMVYRQVSE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcttgcccaagaaattattcgtaaaaagcgtgatggtcatcctttaactgaagaa
gagatccgttttttcattaatggcgtcagagataatactgtttctgaaggtcaaattgca
gcacttgcaatgacaatttattttcatgatatgaccatgcctgaacgtgtggctttgaca
ttagccatgcgtgattccggtactgtactaaactggaaaagtctaaacttaaatggtcct
attgttgataaacactcaacaggcggtgttggcgatgttacatcactgatgttagggcca
atggtagctgcttgtggtggttatgttccgatgatttctggtcgtggattaggtcatact
ggtggaactcttgataagcttgaggctattcccggctttgatattttccctgatgatgaa
aaattccgcgatattattcgtcatgttggtgtagcaattattgggcaaaccaattcatta
gcacctgctgataaacgcttttacgctacacgtgatattactgctaccgttgattcaatc
ccgcttatcactgcatctattttaggtaaaaaattagctgaaggtttggatgcattagtg
atggacgttaaagttggctcaggtgcctttatgccaacatatcagaaatctgaagagcta
gcagaatcaattgtacaagtagcaaatggcgcaggatgccaaactacagcactactgact
gatatgaatgaagtattagcatcaagtgcaggtaatgcagtggaagtccgtgaagcagta
caattcttaacgggtgaataccgtaatccacgcttatttgaagttacgatggcattgtgt
gtagaaatgttagtgtcaggtcgtttagctgactcacgtcaacaagctcgccaaaaactg
caagatgtactggataacggtaaagcagcggaagtctttgctcgtatggttgctgcccaa
aatggtcctacagattttgttgaaaactacaataaatacctgccaacggcggtattaagt
aagcctgtatttgctgagaaagccggttttgtcacagaaatggatacccgagctttaggt
atgtcagttgtgactttaggcggtggtcgccgtaaagcaactgatgctattgattacagt
gttggattaagtgaaatcgcggcactaggaacagaaatcaatacagatacaccactcgcg
atgatccatgccaatagtgaaaaatcatggcaagaagctgcggcagaagtccgtaaagcg
atggtaattggtgagacaaaacgtgaaacgtcaccaatggtgtatcgccaagtcagcgaa
taa

DBGET integrated database retrieval system