KEGG   Proteus mirabilis BB2000: BB2000_3117Help
Entry
BB2000_3117       CDS       T02789                                 

Gene name
celY
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pmib  Proteus mirabilis BB2000
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmib00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BB2000_3117 (celY)
Enzymes [BR:pmib01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BB2000_3117 (celY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3403037..3404011
Genome map
AA seq 324 aa AA seqDB search
MLMISPITQATETQAGWQQFKARYITPEGRVIDSANQNISHSEGQGYGMLMAVMSDDRQT
FAQLWHWTAMSLYRGDLGLFKWRYEPENNQHTPDPNNATDGDILIAWALLKAGEKWHDES
YLSASDSIQHAILEHTLVKTENYSVLLPGINGFKTPEEIIINPSYFIFPAWKDFYRVSHD
SRWKNLINDSQSLLRKMRFGKYKLPSDWVSLYPDGHFAPSEKWPARFSFDAIRIPLYLAW
AQDKLALQPFVNYWQQFDRDKTPAWISIDGKERADYNLTPGMMAVRDLTMKTAIENVDLT
KDTDYYSSALHLLAAFAQNNHNDY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgatatccccaatcacacaagcgacagaaacccaagcaggatggcaacaattt
aaagcgcgttacattactcccgaggggcgtgtcattgacagtgctaatcaaaatatttca
cactcagaaggtcaaggatatggcatgttaatggcggttatgagtgacgatcgccaaacc
tttgcacaattatggcactggacggcaatgtcgctgtatcgtggtgatcttggcttattt
aaatggcgttatgaacccgaaaataaccaacatacacccgatcctaataatgcaacagat
ggtgatattttaattgcttgggcattattaaaggctggggaaaaatggcatgatgaaagc
tatctttcagcatcagattctattcagcatgcgatccttgaacacactttagtgaagaca
gaaaactacagtgtactcttaccgggaattaatggttttaaaacccccgaagaaattatc
attaacccctcctattttatctttccggcatggaaagatttctatcgagttagtcatgat
agccgctggaaaaatttaattaacgatagccaatccttattaagaaaaatgcgttttggt
aaatataaattaccaagtgattgggtaagtttataccctgatggtcattttgccccgagt
gaaaaatggccagcacgatttagttttgatgctattcgcattcctctttatttagcatgg
gcacaagataaactcgcattacaacctttcgtgaattattggcaacaatttgatcgtgat
aagacgcctgcgtggatcagtattgatggtaaagagcgcgccgattataacttaacgcca
ggtatgatggcggtaagagatctgacaatgaaaacagcaattgaaaatgttgatttaact
aaggatacggattattactcttcagccttacatttattagccgcctttgcgcagaataat
cacaatgactattaa

DBGET integrated database retrieval system