KEGG   Proteus mirabilis BB2000: BB2000_3245Help
Entry
BB2000_3245       CDS       T02789                                 

Gene name
ppc
Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmib  Proteus mirabilis BB2000
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pmib00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BB2000_3245 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB2000_3245 (ppc)
  Energy metabolism
   00680 Methane metabolism
    BB2000_3245 (ppc)
Enzymes [BR:pmib01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BB2000_3245 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3542000..3544636
Genome map
AA seq 878 aa AA seqDB search
MNQQYSAMRSNVSMLGKLLGDTIKEALGEEILDKVESIRKLSKSSRAGNEVQRQKLLLTL
QNLSNDELLPVARAFNQFLNLTNVAEQYHSISPHGEAASNPVALAKLIERLKDKNFTNQQ
LKQAVEQISIELVLTAHPTEIARRTLIHKLVEVNTCLSQLDHDDLADYERTNIMRRLRQL
VAQSWHTDEIRKIRPTPIDEAKWGFAVVENSLWEGVPAFLREFNEQLEESIDYNLPVEAS
PIRFTSWMGGDRDGNPNVTAEITRHALLLSRWKAADLFLNDIQVLVSELSMTESTPELRE
LAGGADVAEPYREIAKQLRTRLQVTRDYLEQRIKGQQSLPPEGLLIDNSALWEPLYACYQ
SLHQCGMRIIANGQLLDTLRRIRCFGLQLVRLDIRQESTNHTEALSELTQYLELGDYASW
SEEQKQTFLLTELNSKRPLIPTHWQPSEATKEVFETCRVIAESPKDSIASYVISMAKVPS
DVLAVKLLLKEAGADIRLPVAPLFETLEDLNNAESVMTRLFDIPWYRDLIDNKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKLCEKSGVTLTLFHGRGGTIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPQVTISSLAHYAGAILEANLLPPPEPKTAWIEVMDALS
DVSCEMYRGYVRGEKDFVPYFRAATPEGELGKLPLGSRPAKRRPTGGVETLRAIPWIFAW
TQNRLMLPAWLGAGAALQHEIDNGKQAVLDDMCENWPFFNTRIAMLEMVYAKADLWLAEY
YDQRLVEENLWPLGAKLRQQLSDDIKSVLAISKDEHLMADLPWVAESIALRNVYTDPLNV
LQAELLQRSRTHSESDPRIEQALMVTIAGIAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaatattctgctatgcgtagtaatgtcagcatgcttggcaaactactcggc
gacacgataaaagaggcactcggtgaagaaattttagataaagtggaatctatccgaaag
ttatctaagtcatcacgagcaggtaatgaagttcagcgacaaaagctactattaacctta
caaaatctctctaatgatgagttattacctgttgctagagcattcaaccaattcttaaac
ctgactaatgtggcagagcaataccatagcatttctcctcatggcgaggcggcaagtaat
cctgtggcattggctaaattaattgaacggctgaaagataaaaactttactaatcagcaa
ctcaaacaagccgttgaacaaatttcgattgaattagtcttaacggctcatccaacggaa
attgctcgccgtacgcttattcataagctagtggaagtcaatacttgcttatctcagctt
gatcatgatgatcttgccgattatgaacgtaccaatattatgcgccgtttacgccaattg
gttgcgcaatcgtggcataccgatgagatcagaaaaattcgcccaacccctattgatgaa
gcgaaatggggctttgcggtggtcgaaaatagcttatgggaaggtgtgcctgctttctta
cgtgaatttaatgaacagttagaagagtctattgactacaatttaccggtagaagcttct
cctattcgctttacttcatggatggggggagatcgtgatggtaacccaaatgttaccgct
gaaattacccgtcatgcattattacttagtcgctggaaagccgccgatctatttttaaat
gatattcaggtgctcgtttctgagctgtctatgacagaaagcacaccagaattacgtgaa
ttagcgggcggtgccgatgttgccgagccttatcgtgaaatagccaaacaattgcgcact
cgcttacaagtgactcgtgattatttagaacaacgtatcaaaggtcagcaatcattacct
cctgaaggcttactgattgataattcagcactttgggaacctttatatgcttgttaccaa
tcactgcatcagtgtggtatgcgcattattgccaatggacagttattagatactttgcgc
cgtatccgttgttttggattacaactggtgcgactcgatattcgccaagaaagcactaat
cataccgaagcgctgtctgaattaacgcaatatttagagcttggtgattatgctagttgg
tctgaagagcaaaaacagacgtttttactgacagaacttaactctaaacgcccattgatc
cctactcattggcaaccgagtgaagcaactaaagaggtatttgaaacctgtcgggtgatt
gctgagtcaccaaaagattctattgcttcttatgtgatttccatggcgaaagtcccttcg
gatgtattagccgttaaactattactaaaagaagcaggggcagatattcgtttaccggta
gcaccattatttgaaacgttagaagacttaaataacgcagaaagtgtgatgacccgtctg
tttgatattccgtggtatcgcgatttaattgataacaaacagatggtaatgattggttat
tctgactcagcgaaagatgcgggtgtgatggcggcatcgtgggcacaatatcgagcacag
gatgctttaattaagttatgtgagaaatctggcgtgacattaacgctatttcatggccgt
ggaggcactatcggccgtggaggtgcgccggcacatgctgcattattatcacaaccacca
ggtagtttaaaaggtggattgcgggtgacagagcaaggggagatgatccgctttaaattt
ggcttaccgcaagtgactatcagtagtttggctcactatgctggtgcgattttagaggct
aatttattgcctcctccagagccaaaaacagcttggattgaggttatggatgctttatct
gatgtatcttgcgagatgtatcgtggctatgtcagaggcgaaaaagattttgtgccttat
ttccgagcagcgacgccagaaggtgaattaggtaaattaccattaggctctcgacctgct
aaacgtcgcccaacaggaggcgttgaaacattgcgtgctattccgtggatcttcgcttgg
actcagaaccgtttaatgttacccgcatggttaggggccggtgctgctttacagcatgag
atagataacggaaaacaagctgtattggatgatatgtgtgaaaattggcctttctttaat
acccgtattgctatgctagagatggtgtatgcaaaagcggatctatggcttgcggagtat
tacgatcagcgtttagtcgaagaaaatttatggccattaggggcgaaattacgtcaacaa
ctctctgatgatattaagagtgtattagcgatttctaaagatgagcatttaatggcggac
ttaccgtgggttgctgaatctatcgcattgcgtaatgtttatactgatccacttaacgtc
ttacaggcagagctattgcaacgctctcgtactcatagcgagtctgatccacgtattgaa
caagcgttgatggtgactatcgcaggtattgctgcgggtatgcgtaataccggctag

DBGET integrated database retrieval system